Project name: Rat IAPP_4

Status: done

Started: 2026-06-25 07:51:37
Settings
Chain sequence(s) A: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
C: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
B: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
D: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
input PDB
Selected Chain(s) A,C,B,D
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:04)
Show buried residues

Minimal score value
-2.8562
Maximal score value
0.5443
Average score
-0.7734
Total score value
-114.4701

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -1.6272
2 C A -1.2260
3 N A -1.3955
4 T A -1.0122
5 A A 0.0000
6 T A -0.9143
7 C A -0.7783
8 A A 0.0000
9 T A 0.0000
10 Q A -0.9361
11 R A -1.4584
12 L A 0.0000
13 A A 0.0000
14 N A -2.3555
15 F A 0.0000
16 L A 0.0000
17 V A 0.0000
18 R A -2.8562
19 S A 0.0000
20 S A 0.0000
21 N A -2.1892
22 N A -1.5904
23 L A 0.4061
24 G A -0.2356
25 P A -0.7539
26 V A -0.3731
27 L A 0.0000
28 P A -1.1578
29 P A -1.6198
30 T A -1.6397
31 N A -1.9343
32 V A -1.4070
33 G A -1.3930
34 S A -1.0896
35 N A -1.4329
36 T A -0.3691
37 Y A 0.1711
1 K B -1.6821
2 C B -1.1660
3 N B -1.6594
4 T B -1.1131
5 A B 0.0000
6 T B -0.9003
7 C B -0.8058
8 A B 0.0000
9 T B 0.0000
10 Q B -0.8338
11 R B -1.3947
12 L B 0.0000
13 A B 0.0000
14 N B -1.7110
15 F B 0.0000
16 L B 0.0000
17 V B -1.7964
18 R B -2.3566
19 S B 0.0000
20 S B 0.0000
21 N B -1.9820
22 N B -1.4526
23 L B 0.4854
24 G B -0.2005
25 P B -0.6782
26 V B -0.3067
27 L B 0.0000
28 P B -1.0847
29 P B -1.3000
30 T B -1.3778
31 N B -1.5236
32 V B -1.0556
33 G B -1.1095
34 S B -0.9490
35 N B -1.1978
36 T B -0.2536
37 Y B 0.3142
1 K C -1.6026
2 C C -1.2712
3 N C -1.4116
4 T C -0.9665
5 A C 0.0000
6 T C -0.9888
7 C C -0.8229
8 A C 0.0000
9 T C 0.0000
10 Q C -0.7825
11 R C -1.1125
12 L C 0.0000
13 A C 0.0000
14 N C -1.5118
15 F C 0.0000
16 L C 0.0000
17 V C 0.0000
18 R C -2.5647
19 S C 0.0000
20 S C 0.0000
21 N C -2.1428
22 N C -1.5847
23 L C 0.4319
24 G C -0.1571
25 P C -0.6571
26 V C -0.1548
27 L C -0.8629
28 P C -0.9830
29 P C -1.3651
30 T C 0.0000
31 N C -1.5369
32 V C -1.1284
33 G C -1.2339
34 S C -1.2748
35 N C -1.4979
36 T C -0.3132
37 Y C 0.5443
1 K D -1.5620
2 C D -1.2515
3 N D -1.5145
4 T D -0.9844
5 A D 0.0000
6 T D -1.0088
7 C D -0.9606
8 A D 0.0000
9 T D 0.0000
10 Q D -0.9627
11 R D -1.5229
12 L D 0.0000
13 A D 0.0000
14 N D -1.3023
15 F D 0.0000
16 L D 0.0000
17 V D 0.0000
18 R D -2.3053
19 S D 0.0000
20 S D 0.0000
21 N D -2.0783
22 N D -1.5102
23 L D 0.4446
24 G D -0.0686
25 P D -0.7471
26 V D -0.4191
27 L D 0.0000
28 P D -1.1613
29 P D -1.2999
30 T D -1.1508
31 N D -1.5889
32 V D -1.0498
33 G D -1.0464
34 S D -0.9765
35 N D -1.1908
36 T D -0.2552
37 Y D 0.2138
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018