Project name: T135D

Status: done

Started: 2026-07-07 06:48:23
Settings
Chain sequence(s) A: TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIQKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIEDHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:51)
Show buried residues

Minimal score value
-3.5617
Maximal score value
2.0379
Average score
-1.1557
Total score value
-198.778

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
5 T A -0.4954
6 S A -0.9722
7 Q A -0.9563
8 V A -0.2536
9 R A -1.4708
10 Q A -1.9770
11 N A -2.6119
12 Y A 0.0000
13 H A -2.4416
14 Q A -2.4769
15 D A -2.4485
16 S A 0.0000
17 E A -1.5227
18 A A -1.2183
19 A A -1.3182
20 I A 0.0000
21 N A -0.2400
22 R A -1.0500
23 Q A 0.0000
24 I A 0.0000
25 N A -0.5073
26 L A -0.3042
27 E A 0.0000
28 L A -0.5189
29 Y A -0.1133
30 A A 0.0000
31 S A 0.0000
32 Y A 0.3589
33 V A 0.0000
34 Y A 0.0000
35 L A 0.8577
36 S A 0.0449
37 M A 0.0000
38 S A 0.0000
39 Y A 0.3094
40 Y A 0.0000
41 F A 0.0000
42 D A -2.8577
43 R A -2.9395
44 D A -3.3729
45 D A -3.0031
46 V A -1.9803
47 A A -1.8390
48 L A -1.6745
49 K A -2.3821
50 N A -1.7742
51 F A 0.0000
52 A A 0.0000
53 K A -1.7365
54 Y A -0.9152
55 F A 0.0000
56 L A -0.4814
57 H A -1.6789
58 Q A -1.5809
59 S A 0.0000
60 H A -2.4014
61 E A -2.9329
62 E A 0.0000
63 R A -2.7469
64 E A -3.5617
65 H A 0.0000
66 A A 0.0000
67 E A -3.1846
68 K A -2.6092
69 L A 0.0000
70 M A -2.0160
71 K A -2.9413
72 L A 0.0000
73 Q A 0.0000
74 N A -2.6575
75 Q A -2.3607
76 R A -2.1123
77 G A 0.0000
78 G A 0.0000
79 R A -1.4024
80 I A 0.4916
81 F A 2.0379
82 L A 1.2956
83 Q A -1.1511
84 D A -2.3008
85 I A -1.2134
86 Q A -2.4755
87 K A -2.8200
88 P A -1.9899
89 D A -2.8152
90 C A -2.4157
91 D A -3.3174
92 D A -3.3038
93 W A 0.0000
94 E A -2.6434
95 S A -1.7024
96 G A 0.0000
97 L A 0.0000
98 N A -1.3408
99 A A 0.0000
100 M A 0.0000
101 E A -1.3880
102 C A -0.7882
103 A A 0.0000
104 L A -1.4432
105 H A -1.8247
106 L A 0.0000
107 E A 0.0000
108 K A -2.1225
109 N A -2.3754
110 V A 0.0000
111 N A -1.3696
112 Q A -1.9931
113 S A 0.0000
114 L A 0.0000
115 L A -1.3478
116 E A -2.3412
117 L A 0.0000
118 H A -2.1139
119 K A -2.8439
120 L A -2.3235
121 A A 0.0000
122 T A -2.4705
123 D A -2.9323
124 K A -3.0198
125 N A -2.7393
126 D A 0.0000
127 P A -1.6129
128 H A -1.7717
129 L A 0.0000
130 C A -2.0881
131 D A -2.9772
132 F A -1.9521
133 I A 0.0000
134 E A -3.0012
135 D A -3.2393
136 H A -2.1716
137 Y A 0.0000
138 L A -1.1971
139 N A -1.5164
140 E A -1.4655
141 Q A 0.0000
142 V A -0.1107
143 K A -1.9720
144 A A -1.4165
145 I A -1.3739
146 K A -2.4232
147 E A -2.3289
148 L A 0.0000
149 G A -1.7786
150 D A -1.9153
151 H A -1.6332
152 V A -1.5648
153 T A -1.4946
154 N A -1.5099
155 L A 0.0000
156 R A -2.4918
157 K A -2.3316
158 M A -1.0302
159 G A -1.3850
160 A A 0.0000
161 P A -1.6258
162 E A -2.0328
163 S A -0.7486
164 G A 0.0118
165 L A 1.5398
166 A A 0.0000
167 E A 0.2972
168 Y A 1.0756
169 L A 0.6287
170 F A 0.0000
171 D A 0.0000
172 K A -1.7209
173 H A -1.4514
174 T A -0.9131
175 L A -0.9980
176 G A -1.5167
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018