Project name: query_structure

Status: done

Started: 2026-03-16 23:12:52
Settings
Chain sequence(s) A: EVQLQASGGGSVPPGGSLRLSCTASLRAFSTYTMGWFRQAPGKEREFVAASNWRGTDFHDSVRGRFIISRDNTEKTVDLQMNSLKPEDTAIYYCAADGSTWLKRSDYSYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:28)
Show buried residues

Minimal score value
-3.6359
Maximal score value
0.9488
Average score
-0.8865
Total score value
-105.489

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.0989
2 V A -1.2376
3 Q A -1.8249
4 L A 0.0000
5 Q A -1.7767
6 A A -1.1937
7 S A -1.3007
8 G A -1.2306
9 G A -1.1823
10 G A -0.9481
11 S A -0.5660
12 V A -0.4659
13 P A -0.7989
14 P A -1.3847
15 G A -1.2077
16 G A -0.8283
17 S A -1.0531
18 L A -1.0774
19 R A -1.9257
20 L A 0.0000
21 S A -1.0623
22 C A 0.0000
23 T A -1.1647
24 A A 0.0000
25 S A -0.8281
26 L A -0.2454
27 R A -1.5937
28 A A 0.0000
29 F A 0.0000
30 S A -0.5721
31 T A -0.2438
32 Y A 0.0242
33 T A 0.0000
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A -1.4802
39 Q A -2.1732
40 A A -2.0160
41 P A -1.3981
42 G A -1.9449
43 K A -3.3887
44 E A -3.6359
45 R A -2.9382
46 E A -2.5912
47 F A 0.0000
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 S A 0.0000
52 N A -0.0375
53 W A 0.2790
54 R A -1.1784
55 G A -0.6689
56 T A -0.2142
57 D A -0.7822
58 F A -1.0543
59 H A -1.9215
60 D A -2.6259
61 S A -1.8835
62 V A 0.0000
63 R A -2.5793
64 G A -1.5106
65 R A -0.9370
66 F A 0.0000
67 I A 0.9488
68 I A 0.0000
69 S A -0.4597
70 R A -1.5416
71 D A -2.5639
72 N A -2.4966
73 T A -1.9447
74 E A -2.6768
75 K A -2.2472
76 T A 0.0000
77 V A 0.0000
78 D A -0.9131
79 L A 0.0000
80 Q A -0.4517
81 M A 0.0000
82 N A -0.9503
83 S A -1.1294
84 L A 0.0000
85 K A -2.3651
86 P A -1.8765
87 E A -2.4085
88 D A 0.0000
89 T A -1.1840
90 A A 0.0000
91 I A -0.4860
92 Y A 0.0000
93 Y A -0.6681
94 C A 0.0000
95 A A 0.0000
96 A A 0.0000
97 D A 0.0000
98 G A -0.2609
99 S A -0.1346
100 T A 0.2677
101 W A 0.7115
102 L A -0.0150
103 K A -1.4474
104 R A -2.1994
105 S A -2.2244
106 D A -2.3275
107 Y A 0.0000
108 S A -0.4210
109 Y A -0.0136
110 W A 0.0021
111 G A -0.9257
112 Q A -1.5022
113 G A -1.0174
114 T A -1.0919
115 Q A -1.2830
116 V A 0.0000
117 T A -0.8869
118 V A 0.0000
119 S A -0.8372
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018