Project name: be5d1a1fcd2f619

Status: done

Started: 2026-06-26 12:36:51
Settings
Chain sequence(s) A: MSHHHHHHSGMPDETPFEEFFSKLPEFIKKGKEAVESEEMKKLMPEEEREKVLKALENIEKLVSKNTKAVKIALKIIYLNIKDETASEEEKEKLDREWHELVMEYMSLSEEDREEFHELNHNMHIVFEAIERYPILKPVLEILKNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:06)
Show buried residues

Minimal score value
-5.5845
Maximal score value
0.5622
Average score
-1.9296
Total score value
-281.7196

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5622
2 S A -0.6128
3 H A -1.7451
4 H A -2.3361
5 H A -2.7460
6 H A -2.7494
7 H A -2.5731
8 H A -2.0333
9 S A -1.1511
10 G A -0.9582
11 M A -0.3644
12 P A -1.3228
13 D A -2.8870
14 E A -3.2179
15 T A -2.1532
16 P A -1.5321
17 F A -1.3595
18 E A -2.5996
19 E A -2.2426
20 F A 0.0000
21 F A -0.8581
22 S A -1.2938
23 K A -1.4073
24 L A 0.0000
25 P A -2.0587
26 E A -2.8749
27 F A 0.0000
28 I A 0.0000
29 K A -3.8509
30 K A -3.1770
31 G A 0.0000
32 K A -3.3520
33 E A -3.6119
34 A A -2.7201
35 V A 0.0000
36 E A -3.9990
37 S A -3.6321
38 E A -4.1864
39 E A -3.6729
40 M A 0.0000
41 K A -4.2660
42 K A -3.2475
43 L A -1.0748
44 M A 0.0000
45 P A -2.4357
46 E A -3.9624
47 E A -3.8007
48 E A 0.0000
49 R A -3.6040
50 E A -4.3942
51 K A -3.8436
52 V A 0.0000
53 L A -3.0154
54 K A -3.5034
55 A A 0.0000
56 L A 0.0000
57 E A -3.7259
58 N A -2.8297
59 I A 0.0000
60 E A -3.7712
61 K A -3.4697
62 L A 0.0000
63 V A -2.0167
64 S A -2.1563
65 K A -2.7524
66 N A -2.1214
67 T A -1.7715
68 K A -2.1932
69 A A 0.0000
70 V A 0.0000
71 K A -1.5782
72 I A 0.0000
73 A A 0.0000
74 L A 0.0000
75 K A -1.0628
76 I A -0.5968
77 I A 0.0000
78 Y A 0.0000
79 L A 0.0000
80 N A -2.2060
81 I A -1.9099
82 K A -2.4507
83 D A -3.4484
84 E A -2.8294
85 T A -1.9959
86 A A -2.7894
87 S A -2.7258
88 E A -4.0562
89 E A -4.3607
90 E A -4.3853
91 K A -5.3141
92 E A -5.5845
93 K A -5.2351
94 L A 0.0000
95 D A -5.1061
96 R A -4.9642
97 E A -3.8197
98 W A -2.9453
99 H A -2.9328
100 E A -3.0370
101 L A 0.0000
102 V A -0.1918
103 M A -0.3646
104 E A -1.1304
105 Y A -0.2984
106 M A 0.5192
107 S A -0.2037
108 L A 0.0000
109 S A -2.0574
110 E A -3.5532
111 E A -3.8946
112 D A -3.5548
113 R A -3.4487
114 E A -4.1732
115 E A -3.3288
116 F A 0.0000
117 H A -2.8105
118 E A -2.8374
119 L A 0.0000
120 N A -1.7626
121 H A -2.0105
122 N A 0.0000
123 M A 0.0000
124 H A -1.7422
125 I A -1.3889
126 V A 0.0000
127 F A -1.7168
128 E A -2.9531
129 A A 0.0000
130 I A 0.0000
131 E A -3.3141
132 R A -3.1313
133 Y A -1.3550
134 P A -1.0305
135 I A -0.1141
136 L A 0.0000
137 K A -1.5988
138 P A -1.2579
139 V A 0.0000
140 L A -1.6032
141 E A -2.6715
142 I A -1.8990
143 L A 0.0000
144 K A -2.6234
145 N A -2.4277
146 S A -1.7836
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018