Project name: query_structure

Status: done

Started: 2026-03-16 23:52:38
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGSLSGIRISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVWRTGGYRHRYLVLGEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)
Show buried residues

Minimal score value
-3.1466
Maximal score value
1.9901
Average score
-0.7216
Total score value
-74.3277

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.5777
2 Q A -1.1698
3 V A 0.0000
4 D A -1.4321
5 I A 0.0000
6 V A 1.2348
7 P A 0.2488
8 S A -0.6088
9 Q A -1.9179
10 G A 0.0000
11 E A -2.8907
12 I A 0.0000
13 S A -1.0962
14 V A -0.3362
15 G A -1.2315
16 E A -2.1370
17 S A -0.9744
18 K A -0.4225
19 F A 1.9901
20 F A 0.0000
21 L A 0.9578
22 C A 0.0000
23 Q A -1.4565
24 V A 0.0000
25 A A -0.5588
26 G A -0.4809
27 S A -0.4780
28 L A -0.5028
29 S A -1.0233
30 G A -1.3003
31 I A -0.9347
32 R A -1.1686
33 I A 0.0000
34 S A 0.0000
35 W A 0.0000
36 F A -1.2363
37 S A -1.2590
38 P A -1.2824
39 N A -2.0181
40 G A -2.1361
41 E A -2.9750
42 K A -2.2538
43 L A 0.0000
44 T A -0.9585
45 P A -0.9280
46 N A -2.0625
47 Q A -2.2690
48 Q A -2.2731
49 R A -1.6774
50 I A -0.9007
51 S A -0.2546
52 V A 0.0000
53 V A 0.7999
54 W A -0.4803
55 N A -1.8070
56 D A -2.9841
57 D A -3.1466
58 S A -2.0771
59 S A 0.0000
60 S A 0.0000
61 T A 0.7740
62 L A 0.0000
63 T A 0.8976
64 I A 0.0000
65 Y A -0.6055
66 N A -1.9045
67 A A 0.0000
68 N A -0.8880
69 I A -0.1242
70 D A -1.5965
71 D A 0.0000
72 A A -0.9809
73 G A -0.5791
74 I A 0.0986
75 Y A 0.0000
76 K A -1.2246
77 C A 0.0000
78 V A 0.0000
79 V A 0.0000
80 W A 0.0146
81 R A -0.7743
82 T A -0.9892
83 G A -0.9061
84 G A -1.0166
85 Y A -0.4518
86 R A -2.3241
87 H A -2.2978
88 R A -2.0277
89 Y A 0.0689
90 L A 1.5292
91 V A 1.2891
92 L A 0.7869
93 G A -0.4439
94 E A -1.9326
95 A A -1.6887
96 T A -0.8002
97 V A 0.0000
98 N A -1.7162
99 V A 0.0000
100 K A -2.3929
101 I A 0.0000
102 F A -0.3884
103 Q A -0.4413
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018