Project name: be805b49c5ca19d

Status: done

Started: 2026-06-22 16:04:42
Settings
Chain sequence(s) B: LALMKALMDGIMAAFKVAEKLIAQLSEETRAKALAEQKAFKARIAELVAK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:49)
Show buried residues

Minimal score value
-3.3265
Maximal score value
1.8797
Average score
-1.0242
Total score value
-51.2085

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L B 1.8797
2 A B 1.1158
3 L B 1.8489
4 M B 1.0840
5 K B -0.6529
6 A B -0.0666
7 L B 0.5581
8 M B -0.3816
9 D B -1.6810
10 G B -1.1089
11 I B -0.5637
12 M B -0.5210
13 A B -0.6066
14 A B -0.2979
15 F B 0.0000
16 K B -1.6202
17 V B 0.2172
18 A B -0.5774
19 E B -2.2013
20 K B -1.9243
21 L B -0.3981
22 I B 0.0000
23 A B -1.1617
24 Q B -1.4705
25 L B -0.9420
26 S B -1.8276
27 E B -3.3173
28 E B -3.3265
29 T B -2.3541
30 R B -2.7231
31 A B -2.2309
32 K B -3.0762
33 A B -2.1238
34 L B -1.2903
35 A B -1.7032
36 E B -2.4021
37 Q B 0.0000
38 K B -2.3613
39 A B -1.3490
40 F B -0.7588
41 K B -1.5812
42 A B -1.5867
43 R B -1.8693
44 I B -0.5392
45 A B -0.9163
46 E B -1.8995
47 L B -0.2063
48 V B 0.0591
49 A B -0.8557
50 K B -1.4972
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018