Project name: bea22ac3ae1e336

Status: done

Started: 2026-06-22 16:07:33
Settings
Chain sequence(s) B: GPLAALRRALAEEMRERMEVMAAIVEQLFGKEKAEEFRKRLKALIERLLA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:14)
Show buried residues

Minimal score value
-4.98
Maximal score value
1.4781
Average score
-1.6276
Total score value
-81.3782

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B 0.0766
2 P B 0.4860
3 L B 1.4781
4 A B 0.6430
5 A B 0.5936
6 L B 1.2912
7 R B -0.4211
8 R B -1.4838
9 A B -0.8818
10 L B -0.9967
11 A B 0.0000
12 E B -3.8152
13 E B -3.8643
14 M B -3.2634
15 R B -4.3130
16 E B -4.3969
17 R B -3.6102
18 M B 0.0000
19 E B -2.2947
20 V B -0.0271
21 M B -0.2297
22 A B 0.0000
23 A B -0.2851
24 I B 1.0282
25 V B 0.0000
26 E B -2.3654
27 Q B -0.8603
28 L B 1.1968
29 F B 0.8132
30 G B -1.6976
31 K B -3.8319
32 E B -4.1622
33 K B -3.6570
34 A B 0.0000
35 E B -4.9800
36 E B -4.5252
37 F B -3.6696
38 R B -4.2940
39 K B -4.1713
40 R B -3.6187
41 L B -2.8801
42 K B -3.1282
43 A B -2.2577
44 L B -1.3482
45 I B 0.0000
46 E B -2.7144
47 R B -2.3149
48 L B -1.1808
49 L B -0.6854
50 A B -0.7590
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018