Project name: bf0b477774ae623

Status: done

Started: 2026-07-01 15:22:17
Settings
Chain sequence(s) B: GPVETVSVSMSTDELLALGPSLRLAFGFGENLEEAVAEAQKQPPHLIVIA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:23)
Show buried residues

Minimal score value
-2.7459
Maximal score value
2.3379
Average score
-0.1671
Total score value
-8.3563

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B -0.3562
2 P B -0.0926
3 V B 0.6468
4 E B -0.7450
5 T B 0.2193
6 V B 1.6490
7 S B 1.3309
8 V B 2.0483
9 S B 0.8150
10 M B 0.2414
11 S B -0.9111
12 T B -0.4917
13 D B -1.8345
14 E B -1.7600
15 L B 0.0000
16 L B 1.0679
17 A B 0.3826
18 L B 1.3112
19 G B 0.8257
20 P B 0.6289
21 S B 0.4902
22 L B 0.4360
23 R B -1.2154
24 L B -0.6013
25 A B -0.8287
26 F B 0.7802
27 G B 0.5581
28 F B 1.2310
29 G B -0.9521
30 E B -2.2408
31 N B -1.3907
32 L B 0.0859
33 E B -1.5765
34 E B -1.9267
35 A B -0.2771
36 V B 0.5384
37 A B -0.9184
38 E B -1.4219
39 A B -1.0016
40 Q B -2.1982
41 K B -2.7459
42 Q B -2.1636
43 P B -1.4721
44 P B -1.3210
45 H B -0.5373
46 L B 1.0673
47 I B 1.5167
48 V B 2.3379
49 I B 1.5566
50 A B 0.8588
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018