Project name: c0154c93bf35a05

Chain sequence(s)	A: SAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:40)

• Minimal score value: -3.6656
• Maximal score value: 0.425
• Average score: -1.3901
• Total score value: -76.454

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
5	S	A	-1.4776
6	A	A	-1.2123
7	V	A	0.0000
8	K	A	-1.1450
9	A	A	0.0000
10	L	A	-0.4452
11	F	A	-0.3687
12	D	A	-2.1085
13	Y	A	0.0000
14	K	A	-2.5356
15	A	A	-2.3979
16	Q	A	-3.0188
17	R	A	-3.6656
18	E	A	-3.1672
19	D	A	-2.3747
20	E	A	0.0000
21	L	A	0.0000
22	T	A	-1.2411
23	F	A	0.0000
24	T	A	-1.5042
25	K	A	-1.6718
26	S	A	-0.8851
27	A	A	0.0000
28	I	A	0.4250
29	I	A	0.0000
30	Q	A	-1.5670
31	N	A	-2.3271
32	V	A	-2.2661
33	E	A	-3.1025
34	K	A	-3.3319
35	Q	A	-3.2584
36	D	A	-2.8595
37	G	A	-1.7949
38	G	A	-1.3754
39	W	A	-1.0916
40	W	A	-1.7473
41	R	A	-2.0039
42	G	A	0.0000
43	D	A	-1.7907
44	Y	A	-0.7979
45	G	A	-0.8675
46	G	A	-1.3489
47	K	A	-1.8406
48	K	A	-2.6204
49	Q	A	-1.9610
50	L	A	-1.1578
51	W	A	-0.8657
52	F	A	0.0000
53	P	A	0.0000
54	S	A	-1.2467
55	N	A	-1.0872
56	Y	A	-0.6337
57	V	A	0.0000
58	E	A	-2.2565
59	E	A	-2.4595