Project name: c032b7f69c996c2

Chain sequence(s)	P: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Selected Chain(s)	P
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with P chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:18)

• Minimal score value: -1.7752
• Maximal score value: 1.9102
• Average score: -0.2403
• Total score value: -7.2091

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
7	H	P	-1.3155
8	A	P	-0.8591
9	E	P	-1.7752
10	G	P	-1.0415
11	T	P	-0.5337
12	F	P	0.4869
13	T	P	-0.1226
14	S	P	-0.4152
15	D	P	-0.9225
16	V	P	0.5317
17	S	P	0.0077
18	S	P	-0.2089
19	Y	P	0.8246
20	L	P	0.6547
21	E	P	-1.2758
22	G	P	-0.8888
23	Q	P	-0.9446
24	A	P	-0.7107
25	A	P	-0.6282
26	K	P	-1.4825
27	E	P	-0.8541
28	F	P	1.2523
29	I	P	1.9102
30	A	P	0.7915
31	W	P	0.7973
32	L	P	1.1283
33	V	P	1.4852
34	K	P	-0.6949
35	G	P	-1.1783
36	R	P	-1.2274