Project name: c032b7f69c996c2

Status: done

Started: 2026-06-04 16:42:19
Settings
Chain sequence(s) P: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
input PDB
Selected Chain(s) P
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with P chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:18)
Show buried residues

Minimal score value
-1.7752
Maximal score value
1.9102
Average score
-0.2403
Total score value
-7.2091

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 H P -1.3155
8 A P -0.8591
9 E P -1.7752
10 G P -1.0415
11 T P -0.5337
12 F P 0.4869
13 T P -0.1226
14 S P -0.4152
15 D P -0.9225
16 V P 0.5317
17 S P 0.0077
18 S P -0.2089
19 Y P 0.8246
20 L P 0.6547
21 E P -1.2758
22 G P -0.8888
23 Q P -0.9446
24 A P -0.7107
25 A P -0.6282
26 K P -1.4825
27 E P -0.8541
28 F P 1.2523
29 I P 1.9102
30 A P 0.7915
31 W P 0.7973
32 L P 1.1283
33 V P 1.4852
34 K P -0.6949
35 G P -1.1783
36 R P -1.2274
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018