Project name: query_structure

Status: done

Started: 2026-03-16 23:55:54
Settings
Chain sequence(s) A: MAQVQFVESGGGTVQDGDFLRLSCTASGDTFSNYHAGWFRQPPGREREFVAAISWTGEGTLYADSVKGQFTISRDNAKNAMYLQMNRLKPEDTAVYYCAAARSVGFTWRSSKSNDYAYWGQGTQVTV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:13)
Show buried residues

Minimal score value
-3.4392
Maximal score value
1.2408
Average score
-0.8102
Total score value
-102.8914

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8400
2 A A -0.0855
3 Q A -0.9320
4 V A -0.3687
5 Q A -0.5732
6 F A 0.0000
7 V A 1.2408
8 E A 0.0278
9 S A -0.4792
10 G A -1.1957
11 G A -1.1835
12 G A -0.7736
13 T A -0.6261
14 V A -0.5722
15 Q A -2.1313
16 D A -3.1706
17 G A -2.2082
18 D A -1.1827
19 F A 0.2184
20 L A -0.4381
21 R A -1.6579
22 L A 0.0000
23 S A -0.4365
24 C A 0.0000
25 T A -0.1192
26 A A 0.0000
27 S A -0.7844
28 G A -1.5977
29 D A -2.5340
30 T A 0.0000
31 F A 0.0000
32 S A -1.6614
33 N A -1.7189
34 Y A -0.9132
35 H A 0.0000
36 A A 0.0000
37 G A 0.0000
38 W A 0.0000
39 F A 0.0000
40 R A 0.0000
41 Q A -1.9697
42 P A 0.0000
43 P A -1.6570
44 G A -2.0100
45 R A -3.3834
46 E A -3.4392
47 R A -2.4895
48 E A -1.8137
49 F A -0.9407
50 V A 0.0000
51 A A 0.0000
52 A A 0.0000
53 I A 0.0000
54 S A 0.0000
55 W A -0.6183
56 T A -0.9139
57 G A -1.2253
58 E A -1.8839
59 G A 0.0000
60 T A -0.5303
61 L A -0.4330
62 Y A -0.8770
63 A A -1.2889
64 D A -2.4028
65 S A -1.5887
66 V A 0.0000
67 K A -2.5345
68 G A -1.8574
69 Q A -1.3555
70 F A 0.0000
71 T A -0.7742
72 I A 0.0000
73 S A -0.6841
74 R A -1.1784
75 D A -1.7514
76 N A -2.1707
77 A A -1.6743
78 K A -2.4734
79 N A -2.0370
80 A A 0.0000
81 M A 0.0000
82 Y A -0.6596
83 L A 0.0000
84 Q A -0.8103
85 M A 0.0000
86 N A -1.1325
87 R A -2.5008
88 L A 0.0000
89 K A -2.9796
90 P A -2.1765
91 E A -2.5079
92 D A 0.0000
93 T A -1.0314
94 A A 0.0000
95 V A -0.6504
96 Y A 0.0000
97 Y A -0.2337
98 C A 0.0000
99 A A 0.0000
100 A A 0.0000
101 A A 0.0000
102 R A -1.2209
103 S A 0.0026
104 V A 1.2150
105 G A 0.7153
106 F A 0.9630
107 T A -0.0525
108 W A -0.2891
109 R A -1.6796
110 S A -1.3848
111 S A -1.5180
112 K A -2.5418
113 S A -1.7582
114 N A -1.9679
115 D A -1.3185
116 Y A 0.0000
117 A A -0.3181
118 Y A 0.3445
119 W A 0.4325
120 G A -0.0400
121 Q A -0.8716
122 G A -0.6120
123 T A 0.0000
124 Q A -1.3043
125 V A 0.0000
126 T A -0.9038
127 V A -1.1275
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018