Project name: 13.P1C10.pdb

Chain sequence(s)	H: QVQLVESGGGLVQVGGSLRLSCAVSGRTFSSLYMGWFRQAPGKEREFVAAISKSSGTTNYGDSVKGRFTISRDNAKSTVYLQMDSLLLEDTAVYYCAAGAPPWVGAYSYVPSPASAYAYWGQGTQVTVSS
Selected Chain(s)	H
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:46)

• Minimal score value: -2.6795
• Maximal score value: 2.1387
• Average score: -0.3997
• Total score value: -51.9548

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	H	-1.6030
2	V	H	-1.0404
3	Q	H	-0.9248
4	L	H	0.0000
5	V	H	0.2689
6	E	H	-0.3035
7	S	H	-0.7355
8	G	H	-0.9370
9	G	H	-0.5829
11	G	H	0.1856
12	L	H	1.1635
13	V	H	0.7062
14	Q	H	-0.1836
15	V	H	0.5167
16	G	H	-0.1799
17	G	H	-0.1944
18	S	H	-0.7032
19	L	H	-0.4584
20	R	H	-1.2510
21	L	H	0.0000
22	S	H	-0.3562
23	C	H	0.0000
24	A	H	-0.3630
25	V	H	0.0000
26	S	H	-1.1148
27	G	H	-1.7073
28	R	H	-2.2562
29	T	H	-1.2771
30	F	H	0.0000
35	S	H	-1.2418
36	S	H	-0.9412
37	L	H	0.0000
38	Y	H	-0.2250
39	M	H	0.0000
40	G	H	0.0000
41	W	H	0.0000
42	F	H	0.0000
43	R	H	0.0000
44	Q	H	-1.2844
45	A	H	-1.3310
46	P	H	-0.9910
47	G	H	-1.4114
48	K	H	-2.1241
49	E	H	-2.6795
50	R	H	-1.7742
51	E	H	-1.5821
52	F	H	0.0000
53	V	H	0.0000
54	A	H	0.0000
55	A	H	0.0000
56	I	H	0.0000
57	S	H	0.0000
58	K	H	-2.1183
59	S	H	-1.4629
62	S	H	-1.2165
63	G	H	-0.9009
64	T	H	-0.5029
65	T	H	-0.1847
66	N	H	-0.3917
67	Y	H	-0.9962
68	G	H	-1.3786
69	D	H	-2.4044
70	S	H	-1.7402
71	V	H	0.0000
72	K	H	-2.2680
74	G	H	-1.5810
75	R	H	-1.2183
76	F	H	0.0000
77	T	H	-0.7407
78	I	H	0.0000
79	S	H	-0.4281
80	R	H	0.0000
81	D	H	-2.0785
82	N	H	-2.3257
83	A	H	-1.5375
84	K	H	-2.3009
85	S	H	-1.8137
86	T	H	0.0000
87	V	H	0.0000
88	Y	H	-0.3693
89	L	H	0.0000
90	Q	H	-0.8263
91	M	H	0.0000
92	D	H	-1.0379
93	S	H	-0.5634
94	L	H	0.0000
95	L	H	0.4487
96	L	H	0.3598
97	E	H	-1.0796
98	D	H	0.0000
99	T	H	-0.1593
100	A	H	0.0000
101	V	H	-0.2465
102	Y	H	0.0000
103	Y	H	-0.1141
104	C	H	0.0000
105	A	H	0.0000
106	A	H	0.0000
107	G	H	0.0000
108	A	H	0.3674
109	P	H	0.3065
110	P	H	0.7358
111	W	H	1.7325
111A	V	H	2.1387
111B	G	H	1.2119
111C	A	H	1.3428
111D	Y	H	1.7069
111E	S	H	0.9504
112E	Y	H	1.4960
112D	V	H	0.8937
112C	P	H	0.6073
112B	S	H	-0.1962
112A	P	H	-0.2409
112	A	H	-0.3093
113	S	H	-0.2262
114	A	H	-0.0542
115	Y	H	0.0000
116	A	H	0.3028
117	Y	H	0.2702
118	W	H	0.2178
119	G	H	-0.3219
120	Q	H	-1.1546
121	G	H	-0.6289
122	T	H	-0.7299
123	Q	H	-0.8518
124	V	H	0.0000
125	T	H	0.3520
126	V	H	0.0000
127	S	H	0.1659
128	S	H	0.0551