Project name: Diptericin

Status: done

Started: 2026-04-12 13:35:26
Settings
Chain sequence(s) A: DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)
Show buried residues

Minimal score value
-4.215
Maximal score value
1.032
Average score
-1.3672
Total score value
-60.1582

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.9940
2 C A -0.4593
3 L A -0.3213
4 S A 0.0000
5 G A -1.2937
6 R A -2.3952
7 Y A -1.3796
8 K A -2.2837
9 G A -1.4417
10 P A -0.6673
11 C A 0.0000
12 A A 0.3359
13 V A 1.0320
14 W A 0.7018
15 D A -1.1308
16 N A -2.0745
17 E A -3.2387
18 T A -2.3370
19 C A 0.0000
20 R A -4.2150
21 R A -4.1707
22 V A -3.0366
23 C A 0.0000
24 K A -4.1807
25 E A -3.8429
26 E A -2.8254
27 G A -2.4361
28 R A -2.7202
29 S A -2.2750
30 S A -3.0429
31 G A 0.0000
32 H A -1.8602
33 C A 0.0000
34 S A 0.0000
35 P A -0.0851
36 S A -0.1377
37 L A 0.0945
38 K A -0.7755
39 C A 0.0000
40 W A -0.6760
41 C A 0.0000
42 E A -2.9336
43 G A -1.6233
44 C A -0.4687
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018