Project name: c0d6276f6cf56e1

Chain sequence(s)	A: YVLTQPPSVSVAPGKTARIACEGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPDRFSGSNSGNTAALTISRVEAGDEADYFCQVWDSNSNHQVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:09)

• Minimal score value: -3.1951
• Maximal score value: 1.8203
• Average score: -0.9329
• Total score value: -195.9168

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	Y	A	1.1717
3	V	A	1.8203
4	L	A	0.0000
5	T	A	-0.2193
6	Q	A	0.0000
7	P	A	-0.7348
8	P	A	-1.0177
9	S	A	-1.0360
11	V	A	-0.8263
12	S	A	-0.4198
13	V	A	0.0000
14	A	A	-0.8429
15	P	A	-1.5952
16	G	A	-2.3187
17	K	A	-2.6991
18	T	A	-2.1872
19	A	A	0.0000
20	R	A	-1.8536
21	I	A	0.0000
22	A	A	-0.8721
23	C	A	0.0000
24	E	A	-2.1382
25	G	A	-1.7497
26	N	A	-2.4648
27	N	A	-3.0255
28	I	A	0.0000
29	G	A	-2.0297
36	S	A	-1.4232
37	K	A	-1.4116
38	S	A	-1.0812
39	V	A	0.0000
40	H	A	-0.5669
41	W	A	0.0000
42	Y	A	0.7144
43	Q	A	-0.3414
44	Q	A	-1.1464
45	K	A	-1.8405
46	P	A	-1.5457
47	G	A	-1.3645
48	Q	A	-1.5833
49	A	A	-0.5430
50	P	A	-0.0238
51	V	A	1.2151
52	L	A	1.0776
53	V	A	0.0000
54	V	A	0.0000
55	Y	A	-1.3348
56	D	A	-2.5492
57	D	A	-2.0006
65	S	A	-1.7421
66	D	A	-2.4025
67	R	A	-1.8184
68	P	A	-0.7602
69	S	A	-0.7699
70	G	A	-0.7689
71	I	A	-0.6488
72	P	A	-1.2616
74	D	A	-2.3556
75	R	A	-1.8390
76	F	A	0.0000
77	S	A	-1.3055
78	G	A	-1.2234
79	S	A	-0.9351
80	N	A	-1.5129
83	S	A	-1.5298
84	G	A	-2.2218
85	N	A	-3.0429
86	T	A	-1.9653
87	A	A	0.0000
88	A	A	-0.8986
89	L	A	0.0000
90	T	A	-1.1338
91	I	A	0.0000
92	S	A	-2.3848
93	R	A	-3.0957
94	V	A	0.0000
95	E	A	-2.7432
96	A	A	-1.3745
97	G	A	-1.3373
98	D	A	0.0000
99	E	A	-1.4476
100	A	A	0.0000
101	D	A	-2.0325
102	Y	A	0.0000
103	F	A	0.0528
104	C	A	0.0000
105	Q	A	0.4340
106	V	A	0.0000
107	W	A	-0.2055
108	D	A	0.0000
109	S	A	-1.4801
110	N	A	-1.7834
113	S	A	-1.5963
114	N	A	-2.2703
115	H	A	-2.0176
116	Q	A	-0.9421
117	V	A	0.6803
118	F	A	1.7005
119	G	A	0.0000
120	G	A	-0.1882
121	G	A	-0.7024
122	T	A	0.0000
123	K	A	-2.4202
124	V	A	0.0000
125	T	A	-0.5449
126	V	A	0.0000
127	L	A	0.6817
128	G	A	-0.3133
129	Q	A	0.0000
130	P	A	-1.1172
131	K	A	-2.2705
132	A	A	-1.3510
133	A	A	-0.8111
134	P	A	0.0000
135	S	A	-0.3105
136	V	A	0.0000
137	T	A	0.2197
138	L	A	0.6529
139	F	A	1.5627
140	P	A	0.5885
141	P	A	0.0000
142	S	A	-0.9950
143	S	A	-1.7402
144	E	A	-2.7467
145	E	A	-2.3404
146	L	A	-2.1330
147	Q	A	-2.4501
148	A	A	-2.1398
149	N	A	-2.8687
150	K	A	-3.0033
151	A	A	0.0000
152	T	A	-0.1236
153	L	A	0.0000
154	V	A	1.1337
155	C	A	0.0000
156	L	A	0.9751
157	I	A	0.0000
158	S	A	-0.7938
159	D	A	-1.9254
160	F	A	0.0000
161	Y	A	-1.3172
162	P	A	-1.1557
163	G	A	-0.9117
164	A	A	-0.1847
165	V	A	-0.0614
166	T	A	-0.0991
167	V	A	-0.0970
168	A	A	-0.6201
169	W	A	0.0000
170	K	A	-1.4890
171	A	A	0.0000
172	D	A	-1.4282
173	S	A	-1.0750
174	S	A	-0.9854
175	P	A	-1.0981
176	V	A	-0.9879
177	K	A	-1.8935
178	A	A	-1.0206
179	G	A	-0.9289
180	V	A	-0.8002
181	E	A	-1.7157
182	T	A	-0.5549
183	T	A	-0.5066
184	T	A	-0.3120
185	P	A	-0.5896
186	S	A	-1.2784
187	K	A	-2.6608
188	Q	A	-2.4568
189	S	A	-1.7178
190	N	A	-2.3358
191	N	A	-2.3264
192	K	A	-2.3173
193	Y	A	-1.6350
194	A	A	-0.8770
195	A	A	0.0000
196	S	A	0.1268
197	S	A	0.0000
198	Y	A	0.3800
199	L	A	0.0000
200	S	A	-0.6116
201	L	A	-0.8108
202	T	A	-1.8839
203	P	A	-2.5152
204	E	A	-3.1951
205	Q	A	-2.3762
206	W	A	0.0000
207	K	A	-3.1145
208	S	A	-2.4131
209	H	A	-2.3135
210	K	A	-2.3383
211	S	A	-1.4961
212	Y	A	0.0000
213	S	A	-1.1926
214	C	A	0.0000
215	Q	A	-1.2985
216	V	A	0.0000
217	T	A	-0.6841
218	H	A	0.0000
219	E	A	-2.2861
220	G	A	-1.4194
221	S	A	-0.8358
222	T	A	-0.7456
223	V	A	-0.7743
224	E	A	-2.1566
225	K	A	-1.5798
226	T	A	-0.8661
227	V	A	-0.0295
228	A	A	-0.6386
229	P	A	-0.8854
230	T	A	-0.2831