Project name: c0f70fe5035e2db

Status: done

Started: 2026-06-22 16:06:54
Settings
Chain sequence(s) B: LMDEIMKLTEEIKELMKKAVEALKEDPEKAEEYVKEVKEKAKELNALFAK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:17)
Show buried residues

Minimal score value
-4.7829
Maximal score value
1.136
Average score
-2.3264
Total score value
-116.3183

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L B 1.1360
2 M B 0.7872
3 D B -1.5263
4 E B -1.7989
5 I B 0.0000
6 M B -1.0379
7 K B -2.8832
8 L B 0.0000
9 T B -2.4563
10 E B -3.7326
11 E B -3.5959
12 I B -3.2442
13 K B -3.9966
14 E B -3.9063
15 L B 0.0000
16 M B -1.9928
17 K B -2.8073
18 K B -2.4006
19 A B 0.0000
20 V B -1.0709
21 E B -2.4976
22 A B 0.0000
23 L B -1.6161
24 K B -2.6171
25 E B -3.4172
26 D B -3.4665
27 P B -3.0003
28 E B -3.9559
29 K B -4.3805
30 A B 0.0000
31 E B -3.9408
32 E B -4.4885
33 Y B -3.1549
34 V B -2.7767
35 K B -4.0496
36 E B -4.1043
37 V B -3.6410
38 K B -4.3190
39 E B -4.7829
40 K B -3.9342
41 A B -3.5309
42 K B -4.1724
43 E B -3.6597
44 L B -2.1508
45 N B -2.1756
46 A B -1.4516
47 L B -0.2659
48 F B 1.0110
49 A B -0.2680
50 K B -0.9847
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018