Project name: query_structure

Status: done

Started: 2026-03-17 00:42:31
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVNQWYMAWYRQAPGKEREWVAAIRSTGVKTWYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDDGWQWDNYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:52)
Show buried residues

Minimal score value
-3.5853
Maximal score value
0.926
Average score
-0.8731
Total score value
-104.7735

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.3523
2 V A -0.5776
3 Q A -0.5408
4 L A 0.0000
5 V A 0.8929
6 E A 0.0000
7 S A -0.6381
8 G A -1.0345
9 G A -0.8406
10 G A -0.0735
11 L A 0.9260
12 V A 0.0000
13 Q A -1.2805
14 A A -1.3596
15 G A -1.2765
16 G A -0.8717
17 S A -1.2097
18 L A -0.9434
19 R A -2.1356
20 L A 0.0000
21 S A -0.4330
22 C A 0.0000
23 A A -0.1287
24 A A 0.0000
25 S A -0.5743
26 G A -0.8911
27 F A -0.7181
28 P A -1.3941
29 V A 0.0000
30 N A -2.3792
31 Q A -2.1510
32 W A 0.0000
33 Y A -1.5588
34 M A 0.0000
35 A A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 R A 0.0000
39 Q A -2.0972
40 A A -2.0313
41 P A -1.4329
42 G A -1.9736
43 K A -3.3692
44 E A -3.5853
45 R A -2.8059
46 E A -1.8933
47 W A -0.5805
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 R A -1.4261
53 S A -1.6698
54 T A -0.7686
55 G A -0.5654
56 V A 0.6916
57 K A -0.8062
58 T A -0.2327
59 W A -0.1555
60 Y A -0.5643
61 A A -1.2290
62 D A -2.3513
63 S A -1.7289
64 V A 0.0000
65 K A -2.5498
66 G A -1.7918
67 R A -1.4766
68 F A 0.0000
69 T A -0.7953
70 I A 0.0000
71 S A -0.5700
72 R A -1.2745
73 D A -2.1053
74 N A -2.7829
75 A A -1.8529
76 K A -2.4570
77 N A -2.0183
78 T A 0.0000
79 V A 0.0000
80 Y A -0.6658
81 L A 0.0000
82 Q A -1.2447
83 M A 0.0000
84 N A -1.3716
85 S A -1.1342
86 L A 0.0000
87 K A -2.0734
88 P A -1.8141
89 E A -2.2559
90 D A 0.0000
91 T A -0.9245
92 A A 0.0000
93 V A -0.6092
94 Y A 0.0000
95 Y A -0.2150
96 C A 0.0000
97 N A 0.0000
98 V A 0.0000
99 K A -1.9888
100 D A -2.2986
101 D A -1.4765
102 G A -0.6113
103 W A 0.1714
104 Q A -1.0499
105 W A -0.3095
106 D A -2.0470
107 N A -2.4295
108 Y A -1.6650
109 D A -2.0994
110 Y A -0.6352
111 W A -0.0702
112 G A -0.0076
113 Q A -0.9203
114 G A 0.0000
115 T A 0.0000
116 Q A -1.1576
117 V A 0.0000
118 T A -0.3254
119 V A 0.0000
120 S A -0.7511
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018