Project name: query_structure

Status: done

Started: 2026-03-17 01:00:48
Settings
Chain sequence(s) A: IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
I: RICPRIWMECTRDSDCMAKCICVAGHCG
input PDB
Selected Chain(s) A,I
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:40)
Show buried residues

Minimal score value
-3.1354
Maximal score value
1.3277
Average score
-0.5333
Total score value
-133.8633

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
16 I A 0.0000
17 V A 0.0000
18 G A -1.0787
19 G A -0.3533
20 Y A 0.8988
21 T A 0.5702
22 C A 0.0000
23 A A -0.1078
24 A A -0.5893
25 N A -1.3309
26 S A -0.6792
27 I A 0.0000
28 P A -0.3742
29 Y A 0.1854
30 Q A 0.0000
31 V A 0.0000
32 S A 0.0000
33 L A 0.0000
34 N A -0.9526
37 S A -1.1809
38 G A -0.9165
39 S A -0.4800
40 H A 0.0000
41 F A 0.0000
42 C A 0.0000
43 G A 0.0000
44 G A 0.0000
45 S A 0.0000
46 L A 0.0000
47 I A -0.0220
48 N A -0.3369
49 S A -0.3477
50 Q A -0.7863
51 W A 0.0000
52 V A 0.0000
53 V A 0.0000
54 S A 0.0000
55 A A 0.0000
56 A A 0.0000
57 H A 0.0000
58 C A 0.0000
59 Y A 0.3977
60 K A -1.0165
61 S A -1.3026
62 R A -2.3776
63 I A 0.0000
64 Q A -1.1772
65 V A 0.0000
66 R A -0.2577
67 L A 0.0000
69 G A 0.0000
70 E A 0.0000
71 H A -0.4251
72 N A 0.0748
73 I A -0.0241
74 D A -0.6051
75 V A 1.3277
76 L A 1.0673
77 E A -0.7315
78 G A -1.0259
79 N A -1.8803
80 E A -0.8567
81 Q A -0.4137
82 F A 0.3575
83 I A -0.4144
84 N A -1.6633
85 A A -1.2727
86 A A -1.0177
87 K A -0.9016
88 I A -0.0551
89 I A 0.4504
90 T A 0.1833
91 H A -0.4594
92 P A -0.7929
93 N A -1.4083
94 F A -0.8154
95 N A -1.2800
96 G A -1.1761
97 N A -1.7142
98 T A -0.9352
99 L A 0.0000
100 D A -0.9087
101 N A 0.0000
102 D A 0.0000
103 I A 0.0000
104 M A 0.0000
105 L A 0.0000
106 I A 0.0000
107 K A -1.0720
108 L A 0.0000
109 S A -0.9938
110 S A -0.7517
111 P A -0.5374
112 A A 0.0000
113 T A -0.0542
114 L A 0.3258
115 N A -0.7899
116 S A -0.9048
117 R A 0.0000
118 V A 0.0000
119 A A 0.0049
120 T A 0.0360
121 V A 0.0000
122 S A -0.5182
123 L A -0.3975
124 P A 0.0000
125 R A -1.7215
127 S A -0.7785
128 C A 0.0212
129 A A -0.3542
130 A A -0.2321
132 A A -0.4688
133 G A -0.8289
134 T A -1.2647
135 E A -2.4804
136 C A 0.0000
137 L A -0.9542
138 I A 0.0000
139 S A 0.0000
140 G A 0.0000
141 W A 0.0000
142 G A 0.0000
143 N A 0.0000
144 T A -0.7563
145 K A -1.6221
146 S A -1.3640
147 S A -0.9632
148 G A -0.8434
149 S A -0.6998
150 S A -0.5341
151 Y A 0.0419
152 P A -0.0941
153 S A -0.1070
154 L A 0.3608
155 L A 0.0000
156 Q A 0.2327
157 C A 0.0000
158 L A 0.0000
159 K A -2.0440
160 A A 0.0000
161 P A -1.1948
162 V A 0.0000
163 L A -0.3317
164 S A -0.8297
165 N A -1.6138
166 S A -1.1975
167 S A -0.9114
168 C A 0.0000
169 K A -1.6012
170 S A -1.2156
171 S A 0.0000
172 Y A 0.0000
173 P A -0.8789
174 G A -0.8902
175 Q A -0.7162
176 I A -0.7480
177 T A -0.6865
178 G A -0.8266
179 N A -0.6512
180 M A 0.0000
181 I A -0.2766
182 C A 0.0000
183 V A 0.0000
184A G A 0.0000
184 F A -0.7272
185 L A -1.2065
186 Q A -2.1655
187 G A -2.1701
188A G A -1.7872
188 K A -1.8581
189 D A 0.0000
190 S A 0.0000
191 C A 0.0000
192 Q A 0.0000
193 G A 0.0000
194 D A 0.0000
195 S A 0.0000
196 G A 0.0000
197 G A 0.0000
198 P A 0.0000
199 V A 0.0000
200 V A -0.6808
201 C A 0.0000
202 N A -1.8240
203 G A -1.0931
204 Q A -0.9898
209 L A 0.0000
210 Q A 0.0000
211 G A 0.0000
212 I A 0.0000
213 V A 0.0000
214 S A 0.0000
215 W A 0.0000
216 G A 0.0000
217 Y A -0.6050
219 G A -0.6243
220 C A -0.8940
221A A A -1.7045
221 Q A -2.2222
222 K A -3.0109
223 N A -2.0936
224 K A -1.5035
225 P A 0.0000
226 G A 0.0000
227 V A 0.0000
228 Y A 0.0000
229 T A 0.0000
230 K A -0.4054
231 V A 0.0000
232 C A -0.5017
233 N A -0.7001
234 Y A 0.0000
235 V A -0.9352
236 N A -1.7605
237 W A -1.1201
238 I A 0.0000
239 Q A -1.8972
240 Q A -2.0327
241 T A 0.0000
242 I A -1.0689
243 A A -0.8544
244 A A -0.8631
245 N A -1.3221
1 R I -1.1828
2 I I 0.0000
3 C I 0.0000
4 P I 0.0000
5 R I 0.0000
6 I I 0.0000
7 W I -0.1940
8 M I -0.9535
9 E I -2.1370
10 C I 0.0000
11 T I -1.8258
12 R I -3.1354
13 D I -2.8395
14 S I -2.3750
15 D I -2.8978
16 C I -1.6136
17 M I -0.8041
18 A I -1.1610
19 K I -1.8567
20 C I 0.0000
21 I I -0.3389
22 C I -0.7186
23 V I 1.0936
24 A I 0.3081
25 G I -0.9202
26 H I -1.0079
27 C I 0.0000
28 G I -0.0719
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018