Project name: c19d1f168accdce

Status: done

Started: 2026-04-23 02:06:25
Settings
Chain sequence(s) A: EVQLVESGGGLVQPGGSLRLSCAASGSFSSYAMGWFRQAPGKGRELVAYISYSGSSTYTKSSRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAASDGIPGRFEYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:51)
Show buried residues

Minimal score value
-2.8595
Maximal score value
1.2677
Average score
-0.7376
Total score value
-84.8214

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.6091
2 V A 0.0000
3 Q A -1.2537
4 L A 0.0000
5 V A 1.2677
6 E A 0.0000
7 S A -0.5168
8 G A -1.1239
9 G A -0.7656
10 G A 0.1268
11 L A 1.0158
12 V A -0.0375
13 Q A -1.3424
14 P A -1.7044
15 G A -1.5884
16 G A -1.1189
17 S A -1.5874
18 L A -1.1519
19 R A -2.3390
20 L A 0.0000
21 S A -0.3671
22 C A 0.0000
23 A A -0.0654
24 A A 0.0000
25 S A -1.2171
26 G A -1.5922
27 S A -1.4101
28 F A 0.0000
29 S A -0.6916
30 S A -0.7567
31 Y A 0.0000
32 A A 0.0000
33 M A 0.0000
34 G A 0.0000
35 W A 0.0000
36 F A -0.2184
37 R A 0.0000
38 Q A -2.0129
39 A A -1.8469
40 P A -1.3356
41 G A -1.7883
42 K A -2.8595
43 G A -2.5537
44 R A -2.5985
45 E A -1.7251
46 L A -0.2712
47 V A 0.0000
48 A A 0.0000
49 Y A 0.6445
50 I A 0.0000
51 S A 0.1998
52 Y A 0.6012
53 S A -0.0367
54 G A -0.2686
55 S A -0.2694
56 S A -0.0287
57 T A 0.3133
58 Y A 0.5193
59 T A -0.2664
60 K A -1.1976
61 S A -0.9328
62 S A -0.7451
63 R A -1.1770
64 F A 0.0000
65 T A -0.8274
66 I A 0.0000
67 S A -0.4751
68 R A -0.9498
69 D A -1.7849
70 N A -1.7257
71 A A -1.5401
72 K A -2.5054
73 R A -2.2417
74 M A -1.0660
75 V A 0.0000
76 Y A -0.6754
77 L A 0.0000
78 Q A -1.7697
79 M A 0.0000
80 N A -2.2123
81 S A -1.5815
82 L A 0.0000
83 R A -2.6011
84 A A -1.8368
85 E A -2.2946
86 D A 0.0000
87 T A -0.9327
88 A A 0.0000
89 V A -0.5933
90 Y A 0.0000
91 Y A -0.0848
92 C A 0.0000
93 A A 0.0000
94 A A 0.0000
95 S A 0.0000
96 D A -2.0924
97 G A -0.9069
98 I A -0.3639
99 P A -0.7918
100 G A -1.4056
101 R A -2.2777
102 F A -1.3828
103 E A -1.7128
104 Y A -1.0366
105 W A 0.0935
106 G A 0.0000
107 Q A -0.6596
108 G A -0.4481
109 T A -0.6569
110 Q A -1.0100
111 V A 0.0000
112 T A -0.3299
113 V A 0.0000
114 S A -0.7816
115 S A -0.6768
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018