Project name: Mb5-11_I18L_I104L_LLLLLL_Enriched

Status: done

Started: 2026-07-06 06:59:27
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRLTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTLTVYAVTWYPRYGYGESGPLSLNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)
Show buried residues

Minimal score value
-2.6924
Maximal score value
1.2582
Average score
-0.7487
Total score value
-81.6133

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3456
2 Q A -0.8286
3 A A -0.6467
4 N A -1.0816
5 S A -0.7824
6 G A -1.1440
7 S A -1.0910
8 L A -0.9594
9 E A -1.8860
10 V A -0.7999
11 V A -0.1307
12 E A -1.5777
13 A A -1.2360
14 S A -1.4077
15 P A -1.6714
16 T A -1.1345
17 S A -1.1664
18 L A 0.0000
19 Q A -1.1614
20 L A 0.0000
21 S A -1.0986
22 W A 0.0000
23 D A -1.9371
24 A A -1.2982
25 F A 0.0000
26 H A -1.2213
27 R A -0.5574
28 Y A 0.4866
29 H A -0.2571
30 N A -0.8212
31 G A -0.0600
32 F A 1.2582
33 T A 0.4406
34 H A -0.1461
35 P A -0.4895
36 V A -1.0680
37 R A -1.3300
38 Y A -0.8511
39 Y A 0.0000
40 R A -0.7985
41 L A 0.0000
42 T A -0.5679
43 Y A -0.3341
44 G A -0.6483
45 E A -1.5057
46 T A -1.2068
47 G A -1.2081
48 G A -1.3659
49 N A -1.5500
50 S A -0.9125
51 P A -0.3668
52 V A 0.4009
53 Q A -0.9665
54 E A -1.6713
55 F A -0.5838
56 T A -0.1653
57 V A -0.4160
58 P A -0.9662
59 G A -1.2185
60 S A -1.2205
61 K A -1.6642
62 S A -1.1068
63 T A -0.8586
64 A A 0.0000
65 T A -0.4784
66 L A 0.0000
67 S A -0.8045
68 G A -0.9930
69 L A 0.0000
70 K A -2.3829
71 P A -1.8787
72 G A -1.1388
73 V A -1.1821
74 D A -2.1173
75 Y A 0.0000
76 T A -0.7757
77 L A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.3333
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5987
85 Y A 0.0000
86 P A -0.4669
87 R A -1.1302
88 Y A 0.6554
89 G A 0.5744
90 Y A 0.8499
91 G A 0.1726
92 E A -0.8078
93 S A 0.0000
94 G A -0.8126
95 P A -0.5660
96 L A -0.4698
97 S A -0.5281
98 L A -0.6303
99 N A -1.7330
100 Y A -1.5416
101 R A -2.4335
102 T A 0.0000
103 E A -1.8010
104 L A -0.9299
105 D A -2.5310
106 K A -2.6924
107 P A -1.7911
108 S A -1.6393
109 Q A -1.6637
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018