Project name: c2b576af43ff046

Status: done

Started: 2026-07-01 15:24:20
Settings
Chain sequence(s) B: GLTVDQQSPETGQLLMQLALQEGELRVQWISVSPSGKQERIETAVLRPVA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:29)
Show buried residues

Minimal score value
-3.201
Maximal score value
1.5142
Average score
-1.0312
Total score value
-51.5605

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B 0.2503
2 L B 1.5142
3 T B 0.8295
4 V B 0.8026
5 D B -1.5594
6 Q B -2.0282
7 Q B -2.0599
8 S B -1.9415
9 P B -1.7048
10 E B -2.1474
11 T B -1.3221
12 G B -1.2393
13 Q B -1.3080
14 L B 0.5509
15 L B 0.1811
16 M B -0.3225
17 Q B -0.4564
18 L B -0.2249
19 A B 0.0000
20 L B -0.2203
21 Q B -1.7631
22 E B -2.9900
23 G B -2.0294
24 E B -2.4969
25 L B -1.8297
26 R B -1.9512
27 V B -0.8852
28 Q B -1.7828
29 W B -0.7441
30 I B -1.0096
31 S B -0.8229
32 V B -0.1203
33 S B -0.7442
34 P B -0.6299
35 S B -0.9755
36 G B -1.5057
37 K B -2.6769
38 Q B -2.5754
39 E B -3.2010
40 R B -2.9333
41 I B -1.2549
42 E B -2.0772
43 T B -1.3015
44 A B -0.5395
45 V B -0.1428
46 L B -0.5514
47 R B -1.6525
48 P B -0.1880
49 V B 1.3470
50 A B 0.8735
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018