Project name: obj1 [mutate: LE45C, WA47C]

Status: done

Started: 2025-02-10 08:55:50
Settings
Chain sequence(s) C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues LE45C,WA47C
Energy difference between WT (input) and mutated protein (by FoldX) 4.13595 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:22)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:36)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:57)
Show buried residues

Minimal score value
-3.3016
Maximal score value
1.748
Average score
-0.7417
Total score value
-89.003

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E C -2.0070
2 V C -0.9430
3 Q C -1.2787
4 L C 0.0000
5 V C 0.5377
6 E C 0.1997
7 S C -0.4097
8 G C -0.8149
9 G C 0.0089
10 G C 0.9223
11 L C 1.4406
12 V C -0.0385
13 Q C -1.3371
14 P C -1.4887
15 G C -1.4134
16 G C -0.9785
17 S C -1.2309
18 L C -0.9630
19 R C -2.1461
20 L C 0.0000
21 S C -0.5418
22 C C 0.0000
23 A C -0.2017
24 A C 0.0000
25 S C -0.2017
26 D C 0.0000
27 F C 1.5458
28 T C 0.2524
29 F C 0.0000
30 R C -2.0330
31 S C -0.8870
32 Y C -1.2169
33 E C -1.1203
34 M C 0.0000
35 S C 0.0000
36 W C 0.0000
37 V C 0.0000
38 R C 0.0000
39 Q C -1.6669
40 A C -1.6412
41 P C -1.3153
42 G C -1.7711
43 K C -2.8721
44 G C -2.6370
45 E C -2.9400 mutated: LE45C
46 E C -2.1365
47 A C -0.7457 mutated: WA47C
48 V C 0.0000
49 S C 0.0000
50 A C 0.4636
51 I C 0.0000
52 S C -0.5349
53 G C -1.2460
54 S C -1.2291
55 G C -1.0812
56 G C -0.7344
57 S C -0.2341
58 T C 0.3603
59 Y C 0.9494
60 Y C -0.2093
61 A C -1.1229
62 D C -2.2970
63 S C -1.7062
64 V C 0.0000
65 K C -2.3263
66 G C -1.6103
67 R C 0.0000
68 F C 0.0000
69 T C -0.6290
70 I C 0.0000
71 S C -0.5614
72 R C -1.3627
73 D C -1.9805
74 N C -2.1902
75 S C -1.7905
76 K C -2.3163
77 N C -1.6491
78 T C 0.0000
79 L C 0.0000
80 Y C -0.6694
81 L C 0.0000
82 Q C -1.2335
83 M C 0.0000
84 N C -1.3326
85 S C -1.2322
86 L C 0.0000
87 R C -2.4721
88 A C -1.8894
89 E C -2.3445
90 D C 0.0000
91 T C -0.4367
92 A C 0.0000
93 I C 0.6401
94 Y C 0.0000
95 Y C 0.1421
96 C C 0.0000
97 A C 0.0000
98 R C 0.0000
99 L C 0.0000
100 R C -3.1410
101 D C -3.3016
102 G C -2.0419
103 F C -1.1150
104 N C -2.3836
105 K C -3.1432
106 G C -1.8381
107 F C -0.8983
108 D C -1.0922
109 Y C -0.2748
110 W C 0.3788
111 G C -0.1680
112 Q C -0.9285
113 G C 0.0586
114 T C 0.5748
115 L C 1.7480
116 V C 0.0000
117 T C 0.3347
118 V C 0.0000
119 S C -0.7749
120 S C -1.0602
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018