Project name: 22-8.pdb

Status: done

Started: 2026-03-19 06:08:21
Settings
Chain sequence(s) H: QVQLVESGGGLVQPGGSLRLSCAASGSISSHNDMSWYREALGNQLELVSFIASGGSTYYADSVKGRFTISRDHAKNTLYLQMNSLRAEDTALYYCNSRTYDGEKTYWGQGTTVTVSS
input PDB
Selected Chain(s) H
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:56)
Show buried residues

Minimal score value
-2.8302
Maximal score value
1.1945
Average score
-0.5977
Total score value
-69.9366

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q H -1.7009
2 V H 0.0000
3 Q H -1.1806
4 L H 0.0000
5 V H 1.1922
6 E H 0.0000
7 S H -0.3124
8 G H -0.8624
9 G H -0.2961
11 G H 0.3262
12 L H 1.1945
13 V H 0.0025
14 Q H -1.3419
15 P H -1.5836
16 G H -1.4053
17 G H -0.9452
18 S H -0.8423
19 L H -0.4952
20 R H -1.3444
21 L H 0.0000
22 S H -0.1726
23 C H 0.0000
24 A H -0.0309
25 A H -0.3823
26 S H -0.8194
27 G H -0.8867
28 S H -0.7777
29 I H 0.0000
30 S H -1.2377
35 S H -1.0767
36 H H -1.2943
37 N H -0.9935
38 D H -0.9483
39 M H 0.0000
40 S H 0.0000
41 W H 0.0000
42 Y H 0.6511
43 R H 0.0000
44 E H -0.4614
45 A H -0.4738
46 L H 0.7443
47 G H -0.5995
48 N H -1.6210
49 Q H -1.4668
50 L H -0.0331
51 E H -0.3626
52 L H 0.8387
53 V H 0.0000
54 S H 0.0000
55 F H 0.8649
56 I H 0.0000
57 A H -0.6785
58 S H -1.1375
59 G H -1.0608
63 G H -0.6676
64 S H -0.2608
65 T H 0.3935
66 Y H 0.9861
67 Y H 0.0394
68 A H -0.7757
69 D H -2.2919
70 S H -1.7609
71 V H 0.0000
72 K H -2.3786
74 G H -1.6732
75 R H -1.5423
76 F H 0.0000
77 T H -0.5071
78 I H 0.0000
79 S H -0.3843
80 R H -1.0513
81 D H -1.5932
82 H H -1.6504
83 A H -1.3428
84 K H -2.2410
85 N H -1.6675
86 T H 0.0000
87 L H 0.0000
88 Y H -0.3956
89 L H 0.0000
90 Q H -0.8096
91 M H 0.0000
92 N H -1.1696
93 S H -1.1773
94 L H 0.0000
95 R H -2.1731
96 A H -1.6462
97 E H -2.2091
98 D H 0.0000
99 T H -0.3803
100 A H 0.0000
101 L H 0.4688
102 Y H 0.0000
103 Y H 0.4728
104 C H 0.0000
105 N H 0.0000
106 S H 0.0000
107 R H -1.2246
108 T H -1.3858
109 Y H -1.0780
110 D H -2.1091
113 G H -2.2520
114 E H -2.8302
115 K H -2.5815
116 T H -1.1197
117 Y H -0.6983
118 W H 0.1616
119 G H -0.0128
120 Q H -0.7690
121 G H -0.1672
122 T H -0.1349
123 T H -0.0253
124 V H 0.0000
125 T H 0.0181
126 V H 0.0000
127 S H -0.7603
128 S H -0.5678
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018