Project name: c2f14c8c67f8a16

Status: done

Started: 2026-07-01 15:24:40
Settings
Chain sequence(s) B: APTATRYQLLSRGPLEKVGQRVATATVIGAGLQAVSISVSGGVVTVTLRL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:13)
Show buried residues

Minimal score value
-2.0132
Maximal score value
2.9252
Average score
0.2204
Total score value
11.0199

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B 0.1565
2 P B 0.3271
3 T B 0.3044
4 A B 0.5578
5 T B -0.1767
6 R B -1.5566
7 Y B -0.8142
8 Q B -1.0289
9 L B 0.3029
10 L B 0.1836
11 S B -0.8836
12 R B -2.0132
13 G B -1.1348
14 P B -0.4470
15 L B 0.5259
16 E B -1.0911
17 K B -1.3856
18 V B 0.0157
19 G B -1.0518
20 Q B -1.8000
21 R B -1.3776
22 V B 0.5907
23 A B 0.3831
24 T B -0.4309
25 A B -0.3340
26 T B -0.2343
27 V B 0.9320
28 I B 1.9892
29 G B 0.0000
30 A B 0.3344
31 G B -0.2147
32 L B 0.0510
33 Q B -1.0811
34 A B 0.2915
35 V B 0.9240
36 S B 1.2260
37 I B 2.9252
38 S B 2.2216
39 V B 2.6706
40 S B 0.9496
41 G B 0.1840
42 G B 0.6009
43 V B 2.1709
44 V B 2.5372
45 T B 1.9996
46 V B 2.2415
47 T B 0.7571
48 L B 0.1899
49 R B -1.0663
50 L B 0.5984
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018