Project name: query_structure

Status: done

Started: 2026-03-16 20:40:10
Settings
Chain sequence(s) A: MAASSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAYEYWEYEYSSYSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:43)
Show buried residues

Minimal score value
-2.5489
Maximal score value
1.5369
Average score
-0.4092
Total score value
-39.2847

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0624
2 A A 0.5097
3 A A 0.3651
4 S A 0.1163
5 S A 0.2833
6 V A 0.3376
7 P A 0.0000
8 T A -1.2615
9 K A -2.3105
10 L A -1.4522
11 E A -1.7538
12 V A 0.0917
13 V A 1.5273
14 A A 0.8771
15 A A 0.2960
16 T A -0.5404
17 P A -1.1571
18 T A -1.0228
19 S A -0.5474
20 L A 0.0000
21 L A 0.7074
22 I A 0.0000
23 S A -0.7314
24 W A 0.0000
25 D A -1.6953
26 A A -0.7968
27 P A -0.0369
28 A A 0.1167
29 V A 0.2571
30 T A 0.0387
31 V A -0.4331
32 D A -0.9342
33 H A -0.9528
34 Y A 0.0000
35 V A 0.0121
36 I A 0.0000
37 T A -0.3738
38 Y A -0.2828
39 G A 0.0000
40 E A -1.6569
41 T A -1.2974
42 G A -1.2485
43 G A -1.3606
44 N A -1.5226
45 S A -0.8210
46 P A -0.3031
47 V A 0.4557
48 Q A -0.7903
49 E A -1.4381
50 F A -0.5178
51 T A -0.1418
52 V A 0.0000
53 P A -1.1544
54 G A -1.3778
55 S A -1.3967
56 K A -1.9945
57 S A -1.2087
58 T A -0.6339
59 A A 0.0000
60 T A 0.2804
61 I A 0.0000
62 S A -0.6660
63 G A -1.0360
64 L A 0.0000
65 K A -2.4045
66 P A -1.6665
67 G A -1.4619
68 V A -1.5210
69 D A -2.1251
70 Y A 0.0000
71 T A -0.7887
72 I A 0.0000
73 T A -0.0562
74 V A 0.0000
75 Y A 0.6079
76 A A 0.0000
77 Y A 0.7592
78 E A 0.3825
79 Y A 1.0938
80 W A 0.7405
81 E A -0.7278
82 Y A 0.3618
83 E A -0.4903
84 Y A 1.0430
85 S A 0.6861
86 S A 0.9438
87 Y A 1.5369
88 S A 0.6971
89 P A 0.5517
90 I A 0.2554
91 S A -0.3391
92 I A -0.5457
93 N A -1.7502
94 Y A -1.4804
95 R A -2.5489
96 T A -1.5238
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018