Project name: DH2

Status: done

Started: 2025-07-17 06:23:40
Settings
Chain sequence(s) A: HHRWIFVCFFLMPLSILFDVYYQLRAWAVRRMHSAPRLHGQRVRHIQEQVREWKEEGGRRYMCTGRPGWLTVSLRVGKYKKTHKNIMINLMDVLEVDSERQVVRVEPLVTMGQLTAYLNPMGWTIPVVPELDDLTVGGLIMGTGIESSSHIYGLFQHTCMAYELVLADGSLVRCSPTENSDLFYAVPWSCGTLGFLVAAEIKMIPAKKYIRLHYEPVRGLRSICEKFTEESKNKENSFVEGLVYSLEEAVIMTGVLTDEAEPSKINRIGNYYKPWFFKHVEKYLKANKTGIEYIPSRHYYHRHTRSIFWELQDIIPFGNNPVFRYLFGWMVPPKISLLKLTQGEAIRKLYEQHHVVQDMLVPMKSLEKSIQTFHVDLNVYPLWLCPFLLPNNPGMVHPKGDETELYVDIGAYGEPKTKQFEARASMRQMEKFVRSVHGFQMLYADCYMTREEFWDMFDGSLYHSLREQMNCKDAFPEVYDKICKAARH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations Yes
Downloads Download all the data
Simulation log 
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:08:46)
[INFO]       Auto_mut: Residue number 9 from chain A and a score of 3.374 (phenylalanine) selected 
                       for automated muatation                                                     (00:08:49)
[INFO]       Auto_mut: Residue number 10 from chain A and a score of 3.124 (phenylalanine)         
                       selected for automated muatation                                            (00:08:49)
[INFO]       Auto_mut: Residue number 325 from chain A and a score of 2.855 (tyrosine) selected    
                       for automated muatation                                                     (00:08:49)
[INFO]       Auto_mut: Residue number 326 from chain A and a score of 2.781 (leucine) selected for 
                       automated muatation                                                         (00:08:49)
[INFO]       Auto_mut: Residue number 327 from chain A and a score of 2.574 (phenylalanine)        
                       selected for automated muatation                                            (00:08:49)
[INFO]       Auto_mut: Residue number 21 from chain A and a score of 2.396 (tyrosine) selected for 
                       automated muatation                                                         (00:08:49)
[INFO]       Auto_mut: Mutating residue number 9 from chain A (phenylalanine) into glutamic acid   (00:08:49)
[INFO]       Auto_mut: Mutating residue number 9 from chain A (phenylalanine) into aspartic acid   (00:08:49)
[INFO]       Auto_mut: Mutating residue number 10 from chain A (phenylalanine) into glutamic acid  
                       Mutating residue number 10 from chain A (phenylalanine) into glutamic acid  (00:08:49)
[INFO]       Auto_mut: Mutating residue number 9 from chain A (phenylalanine) into arginine        (00:12:43)
[INFO]       Auto_mut: Mutating residue number 9 from chain A (phenylalanine) into lysine          (00:12:44)
[INFO]       Auto_mut: Mutating residue number 10 from chain A (phenylalanine) into lysine         (00:12:48)
[INFO]       Auto_mut: Mutating residue number 10 from chain A (phenylalanine) into aspartic acid  
                       Mutating residue number 10 from chain A (phenylalanine) into aspartic acid  (00:16:42)
[INFO]       Auto_mut: Mutating residue number 325 from chain A (tyrosine) into glutamic acid      (00:17:05)
[INFO]       Auto_mut: Mutating residue number 325 from chain A (tyrosine) into aspartic acid      (00:17:09)
[INFO]       Auto_mut: Mutating residue number 10 from chain A (phenylalanine) into arginine       (00:20:34)
[INFO]       Auto_mut: Mutating residue number 325 from chain A (tyrosine) into lysine             (00:21:02)
[INFO]       Auto_mut: Mutating residue number 325 from chain A (tyrosine) into arginine           (00:21:02)
[INFO]       Auto_mut: Mutating residue number 326 from chain A (leucine) into glutamic acid       (00:24:36)
[INFO]       Auto_mut: Mutating residue number 326 from chain A (leucine) into aspartic acid       (00:25:10)
[INFO]       Auto_mut: Mutating residue number 327 from chain A (phenylalanine) into glutamic acid 
                       Mutating residue number 327 from chain A (phenylalanine) into glutamic acid (00:25:16)
[INFO]       Auto_mut: Mutating residue number 326 from chain A (leucine) into lysine              (00:28:32)
[INFO]       Auto_mut: Mutating residue number 326 from chain A (leucine) into arginine            (00:28:58)
[INFO]       Auto_mut: Mutating residue number 327 from chain A (phenylalanine) into lysine        (00:29:11)
[INFO]       Auto_mut: Mutating residue number 327 from chain A (phenylalanine) into aspartic acid 
                       Mutating residue number 327 from chain A (phenylalanine) into aspartic acid (00:32:38)
[INFO]       Auto_mut: Mutating residue number 21 from chain A (tyrosine) into glutamic acid       (00:32:54)
[INFO]       Auto_mut: Mutating residue number 21 from chain A (tyrosine) into aspartic acid       (00:33:27)
[INFO]       Auto_mut: Mutating residue number 327 from chain A (phenylalanine) into arginine      (00:36:48)
[INFO]       Auto_mut: Mutating residue number 21 from chain A (tyrosine) into lysine              (00:37:19)
[INFO]       Auto_mut: Mutating residue number 21 from chain A (tyrosine) into arginine            (00:37:53)
[INFO]       Auto_mut: Effect of mutation residue number 9 from chain A (phenylalanine) into       
                       glutamic acid: Energy difference: 0.4756 kcal/mol, Difference in average    
                       score from the base case: -0.0166                                           (00:42:22)
[INFO]       Auto_mut: Effect of mutation residue number 9 from chain A (phenylalanine) into       
                       lysine: Energy difference: 0.1535 kcal/mol, Difference in average score     
                       from the base case: -0.0210                                                 (00:42:22)
[INFO]       Auto_mut: Effect of mutation residue number 9 from chain A (phenylalanine) into       
                       aspartic acid: Energy difference: 0.7715 kcal/mol, Difference in average    
                       score from the base case: -0.0201                                           (00:42:22)
[INFO]       Auto_mut: Effect of mutation residue number 9 from chain A (phenylalanine) into       
                       arginine: Energy difference: 0.0524 kcal/mol, Difference in average score   
                       from the base case: -0.0250                                                 (00:42:22)
[INFO]       Auto_mut: Effect of mutation residue number 10 from chain A (phenylalanine) into      
                       glutamic acid: Energy difference: 0.5914 kcal/mol, Difference in average    
                       score from the base case: -0.0170                                           (00:42:22)
[INFO]       Auto_mut: Effect of mutation residue number 10 from chain A (phenylalanine) into      
                       lysine: Energy difference: 0.2055 kcal/mol, Difference in average score     
                       from the base case: -0.0209                                                 (00:42:22)
[INFO]       Auto_mut: Effect of mutation residue number 10 from chain A (phenylalanine) into      
                       aspartic acid: Energy difference: 1.6801 kcal/mol, Difference in average    
                       score from the base case: -0.0212                                           (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 10 from chain A (phenylalanine) into      
                       arginine: Energy difference: 0.1045 kcal/mol, Difference in average score   
                       from the base case: -0.0213                                                 (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 325 from chain A (tyrosine) into glutamic 
                       acid: Energy difference: -0.0414 kcal/mol, Difference in average score from 
                       the base case: -0.0269                                                      (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 325 from chain A (tyrosine) into lysine:  
                       Energy difference: -0.1446 kcal/mol, Difference in average score from the   
                       base case: -0.0281                                                          (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 325 from chain A (tyrosine) into aspartic 
                       acid: Energy difference: 0.3855 kcal/mol, Difference in average score from  
                       the base case: -0.0256                                                      (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 325 from chain A (tyrosine) into          
                       arginine: Energy difference: -1.3755 kcal/mol, Difference in average score  
                       from the base case: -0.0305                                                 (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 326 from chain A (leucine) into glutamic  
                       acid: Energy difference: 0.5293 kcal/mol, Difference in average score from  
                       the base case: -0.0268                                                      (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 326 from chain A (leucine) into lysine:   
                       Energy difference: 0.7279 kcal/mol, Difference in average score from the    
                       base case: -0.0207                                                          (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 326 from chain A (leucine) into aspartic  
                       acid: Energy difference: 1.0587 kcal/mol, Difference in average score from  
                       the base case: -0.0253                                                      (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 326 from chain A (leucine) into arginine: 
                       Energy difference: 0.9724 kcal/mol, Difference in average score from the    
                       base case: -0.0251                                                          (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 327 from chain A (phenylalanine) into     
                       glutamic acid: Energy difference: 0.6885 kcal/mol, Difference in average    
                       score from the base case: -0.0112                                           (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 327 from chain A (phenylalanine) into     
                       lysine: Energy difference: 0.3866 kcal/mol, Difference in average score     
                       from the base case: -0.0125                                                 (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 327 from chain A (phenylalanine) into     
                       aspartic acid: Energy difference: 1.4553 kcal/mol, Difference in average    
                       score from the base case: -0.0057                                           (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 327 from chain A (phenylalanine) into     
                       arginine: Energy difference: 0.0314 kcal/mol, Difference in average score   
                       from the base case: -0.0171                                                 (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 21 from chain A (tyrosine) into glutamic  
                       acid: Energy difference: 0.4744 kcal/mol, Difference in average score from  
                       the base case: -0.0264                                                      (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 21 from chain A (tyrosine) into lysine:   
                       Energy difference: 0.3016 kcal/mol, Difference in average score from the    
                       base case: -0.0334                                                          (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 21 from chain A (tyrosine) into aspartic  
                       acid: Energy difference: 0.7906 kcal/mol, Difference in average score from  
                       the base case: -0.0308                                                      (00:42:23)
[INFO]       Auto_mut: Effect of mutation residue number 21 from chain A (tyrosine) into arginine: 
                       Energy difference: -0.9273 kcal/mol, Difference in average score from the   
                       base case: -0.0272                                                          (00:42:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:42:30)
Show buried residues
Minimal score value
-4.913
Maximal score value
3.3744
Average score
-0.663
Total score value
-323.5452
Download the table (csv)

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 H A -1.3631
2 H A -1.0309
3 R A -0.3669
4 W A 0.8144
5 I A 1.8968
6 F A 2.3832
7 V A 0.0000
8 C A 0.0000
9 F A 3.3744
10 F A 3.1243
11 L A 0.0000
12 M A 0.0000
13 P A 1.4407
14 L A 1.5904
15 S A 0.0000
16 I A 1.5975
17 L A 2.0871
18 F A 1.7911
19 D A 1.0302
20 V A 2.0234
21 Y A 2.3963
22 Y A 1.4801
23 Q A 0.8449
24 L A 1.5254
25 R A 0.3173
26 A A 0.2881
27 W A 0.4511
28 A A -0.2185
29 V A 0.0000
30 R A -1.3258
31 R A -1.7045
32 M A -0.5541
33 H A -1.5707
34 S A -0.9683
35 A A -0.5472
36 P A -1.1576
37 R A -1.7564
38 L A -0.6678
39 H A 0.0000
40 G A -1.6633
41 Q A -2.2765
42 R A -2.0729
43 V A 0.0000
44 R A -3.0764
45 H A -2.9206
46 I A 0.0000
47 Q A -2.8614
48 E A -3.7161
49 Q A -2.9468
50 V A 0.0000
51 R A -4.9130
52 E A -4.7183
53 W A 0.0000
54 K A -4.7901
55 E A -4.4673
56 E A -4.5645
57 G A -3.4028
58 G A -3.8250
59 R A -3.7024
60 R A -3.4628
61 Y A -1.7476
62 M A 0.0000
63 C A 0.0000
64 T A -0.4437
65 G A -0.7643
66 R A -0.5303
67 P A -0.3032
68 G A 0.0000
69 W A 1.0355
70 L A 0.7393
71 T A 0.5715
72 V A 0.8043
73 S A 0.7898
74 L A 0.5878
75 R A 0.0000
76 V A 0.2270
77 G A -0.8400
78 K A -1.3199
79 Y A -1.1849
80 K A -1.4867
81 K A -2.2079
82 T A -1.5675
83 H A -1.7500
84 K A -1.6932
85 N A -1.1031
86 I A 0.0000
87 M A -0.3773
88 I A 0.0000
89 N A -1.1908
90 L A 0.0000
91 M A -0.1103
92 D A 0.0000
93 V A 0.0000
94 L A 0.0000
95 E A -2.0210
96 V A -1.3091
97 D A -2.2739
98 S A -2.0761
99 E A -3.0375
100 R A -3.1502
101 Q A -2.1382
102 V A 0.0000
103 V A 0.0000
104 R A -0.9092
105 V A 0.0000
106 E A 0.0000
107 P A 0.0000
108 L A 0.0000
109 V A 0.0000
110 T A 0.0000
111 M A 0.0000
112 G A 0.0000
113 Q A -0.2874
114 L A 0.0000
115 T A 0.0000
116 A A -0.2389
117 Y A 0.0607
118 L A 0.0000
119 N A -0.6672
120 P A -0.2463
121 M A 0.1559
122 G A -0.5437
123 W A -0.1123
124 T A 0.0000
125 I A 0.0000
126 P A 0.0000
127 V A 0.0000
128 V A 0.0000
129 P A 0.0000
130 E A 0.0000
131 L A 0.0621
132 D A -0.4782
133 D A -0.1864
134 L A 0.1507
135 T A -0.0023
136 V A 0.0000
137 G A 0.0000
138 G A -0.1296
139 L A 0.0000
140 I A 0.0000
141 M A 0.0000
142 G A 0.0000
143 T A 0.0483
144 G A 0.0000
145 I A 0.2879
146 E A 0.0000
147 S A 0.0000
148 S A 0.0000
149 S A 0.0000
150 H A 0.0000
151 I A 0.1682
152 Y A 0.8702
153 G A 0.0000
154 L A 0.0000
155 F A 0.0000
156 Q A 0.0000
157 H A -0.1839
158 T A 0.0000
159 C A 0.0000
160 M A 0.0788
161 A A 0.0000
162 Y A 0.0000
163 E A -0.3672
164 L A 0.0000
165 V A 0.0000
166 L A -0.5506
167 A A 0.0000
168 D A -2.4456
169 G A 0.0000
170 S A -0.8114
171 L A 0.0608
172 V A -0.2142
173 R A -1.2401
174 C A 0.0000
175 S A -1.1346
176 P A -0.8525
177 T A -1.1421
178 E A -2.2014
179 N A -2.0655
180 S A -1.7476
181 D A -1.8257
182 L A 0.0000
183 F A 0.0000
184 Y A -0.4699
185 A A 0.0000
186 V A 0.0000
187 P A -0.0340
188 W A 0.0000
189 S A 0.0000
190 C A 0.0000
191 G A -0.1108
192 T A 0.0000
193 L A 0.0000
194 G A 0.0000
195 F A 0.0000
196 L A 0.0000
197 V A 0.0000
198 A A 0.0000
199 A A 0.0000
200 E A 0.0000
201 I A 0.0000
202 K A -1.0141
203 M A 0.0000
204 I A -0.1665
205 P A -0.3320
206 A A -1.0984
207 K A -2.3918
208 K A -3.2332
209 Y A 0.0000
210 I A 0.0000
211 R A -1.2860
212 L A 0.0000
213 H A -0.4447
214 Y A 0.0000
215 E A -1.1011
216 P A -1.9382
217 V A -2.0664
218 R A -2.7846
219 G A -2.2227
220 L A -2.3388
221 R A -3.1112
222 S A -2.4737
223 I A 0.0000
224 C A 0.0000
225 E A -3.3379
226 K A -2.4879
227 F A 0.0000
228 T A -2.4918
229 E A -3.2660
230 E A -2.7260
231 S A 0.0000
232 K A -3.2339
233 N A -3.1998
234 K A -3.2230
235 E A -2.9145
236 N A 0.0000
237 S A -0.5679
238 F A 0.0000
239 V A 0.0000
240 E A 0.0000
241 G A 0.0000
242 L A 0.0000
243 V A 0.0000
244 Y A -0.1666
245 S A -0.6191
246 L A -0.7707
247 E A -1.9893
248 E A -1.9595
249 A A 0.0000
250 V A 0.0000
251 I A 0.0000
252 M A 0.0000
253 T A -0.4793
254 G A 0.0000
255 V A -0.0277
256 L A -0.6818
257 T A -1.9720
258 D A -3.5387
259 E A -3.3707
260 A A -2.3015
261 E A -1.8141
262 P A -1.1798
263 S A -0.8772
264 K A -1.2129
265 I A -0.7482
266 N A 0.0000
267 R A -1.8464
268 I A 0.0000
269 G A -0.9378
270 N A -0.4227
271 Y A 1.2252
272 Y A 1.5919
273 K A -0.1596
274 P A -0.4558
275 W A 0.0000
276 F A 0.0000
277 F A 0.0000
278 K A -1.1194
279 H A 0.0000
280 V A 0.0000
281 E A -1.9551
282 K A -2.8315
283 Y A -2.3337
284 L A 0.0000
285 K A -3.0514
286 A A -2.3949
287 N A -3.1637
288 K A -2.8815
289 T A -1.3049
290 G A -0.7049
291 I A -0.0938
292 E A -0.7421
293 Y A -1.3292
294 I A 0.0000
295 P A -1.5835
296 S A 0.0000
297 R A -1.5029
298 H A -1.1319
299 Y A 0.0000
300 Y A 0.0000
301 H A 0.0000
302 R A 0.0000
303 H A 0.0000
304 T A 0.0000
305 R A -0.0452
306 S A 0.0000
307 I A 0.0112
308 F A 0.0000
309 W A 0.0000
310 E A -0.8785
311 L A 0.0000
312 Q A -1.2448
313 D A -2.0925
314 I A -0.8177
315 I A 0.0000
316 P A -0.7276
317 F A 0.1183
318 G A 0.0000
319 N A -0.3196
320 N A -0.1821
321 P A 0.8217
322 V A 2.3016
323 F A 0.0000
324 R A 1.8430
325 Y A 2.8547
326 L A 2.7813
327 F A 2.5741
328 G A 0.0000
329 W A 2.1985
330 M A 1.1500
331 V A 0.0000
332 P A 0.2006
333 P A 0.0000
334 K A 0.0922
335 I A 0.5766
336 S A 0.0000
337 L A 0.0000
338 L A 0.0000
339 K A 0.0000
340 L A 1.3084
341 T A 0.2875
342 Q A -0.5623
343 G A -1.3487
344 E A -2.2558
345 A A -1.1609
346 I A -0.9035
347 R A -1.5450
348 K A -1.9371
349 L A -0.4553
350 Y A -0.7431
351 E A -1.2132
352 Q A -2.0139
353 H A -1.7570
354 H A 0.0000
355 V A 0.0000
356 V A 0.3312
357 Q A 0.0000
358 D A 0.0099
359 M A 0.0000
360 L A 0.0000
361 V A 0.0000
362 P A 0.0000
363 M A 0.0000
364 K A -2.2288
365 S A 0.0000
366 L A 0.0000
367 E A -2.5217
368 K A -2.4359
369 S A 0.0000
370 I A 0.0000
371 Q A -1.0328
372 T A -0.5826
373 F A 0.0000
374 H A -0.2275
375 V A 0.4865
376 D A 0.0000
377 L A 0.0000
378 N A -1.0428
379 V A 0.0000
380 Y A -0.1416
381 P A 0.0000
382 L A 0.0000
383 W A 0.0000
384 L A 0.0000
385 C A 0.0000
386 P A 0.0000
387 F A 0.0000
388 L A 0.2571
389 L A 0.0000
390 P A -1.1839
391 N A -2.3333
392 N A -1.3051
393 P A -0.8799
394 G A -0.6470
395 M A 0.0000
396 V A 0.0000
397 H A -1.7369
398 P A 0.0000
399 K A -2.8214
400 G A -2.9492
401 D A -3.6008
402 E A -3.5087
403 T A -2.0776
404 E A -1.8271
405 L A -0.6882
406 Y A 0.0000
407 V A 0.0000
408 D A 0.0000
409 I A 0.0000
410 G A 0.0000
411 A A 0.0000
412 Y A -0.0021
413 G A -1.0958
414 E A -2.0366
415 P A -2.2852
416 K A -2.6476
417 T A -2.1619
418 K A -2.7519
419 Q A -2.3328
420 F A -2.1396
421 E A -2.6430
422 A A -2.1491
423 R A -2.6188
424 A A -1.7983
425 S A 0.0000
426 M A 0.0000
427 R A -1.9494
428 Q A -2.0608
429 M A 0.0000
430 E A 0.0000
431 K A -2.2792
432 F A -1.2732
433 V A 0.0000
434 R A -1.4079
435 S A -0.7131
436 V A -0.7988
437 H A -0.8787
438 G A 0.0000
439 F A 0.0000
440 Q A 0.0000
441 M A 0.2161
442 L A 0.0000
443 Y A 0.7011
444 A A 0.0000
445 D A -0.2996
446 C A 0.0000
447 Y A -0.8994
448 M A 0.0000
449 T A -1.8173
450 R A -3.2477
451 E A -3.2699
452 E A -2.6777
453 F A 0.0000
454 W A -2.0644
455 D A -2.8204
456 M A 0.0000
457 F A 0.0000
458 D A -1.2207
459 G A -0.7712
460 S A -0.5004
461 L A -0.4515
462 Y A 0.0000
463 H A -1.3644
464 S A -1.4831
465 L A 0.0000
466 R A 0.0000
467 E A -3.4634
468 Q A -2.6447
469 M A -2.2963
470 N A -3.3298
471 C A 0.0000
472 K A -3.3372
473 D A -3.5515
474 A A 0.0000
475 F A 0.0000
476 P A 0.0000
477 E A -1.0736
478 V A 0.0000
479 Y A -1.4185
480 D A -2.0684
481 K A 0.0000
482 I A 0.0000
483 C A 0.0000
484 K A -0.8300
485 A A -0.6073
486 A A -0.8018
487 R A 0.0000
488 H A -0.7836
Download PDB file
View in 3Dmol
Play the video

Automated mutations analysis

In the automated mutations mode, the server selects aggregation prone resides and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine. The table below shows 2 best scored mutants for each mutated residue. Protein variants are ordered according to the mutation effect they had on protein stability (energetic effect) together with the difference in the average per-residue aggregation score between the wild type and the mutant (in the table green values indicate a positive change, grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this CSV file.

Mutant
Energetic effect
Score comparison
YR325A -1.3755 -0.0305 View CSV PDB
YR21A -0.9273 -0.0272 View CSV PDB
YK325A -0.1446 -0.0281 View CSV PDB
FR327A 0.0314 -0.0171 View CSV PDB
FR9A 0.0524 -0.025 View CSV PDB
FR10A 0.1045 -0.0213 View CSV PDB
FK9A 0.1535 -0.021 View CSV PDB
YK21A 0.3016 -0.0334 View CSV PDB
FK10A 0.2055 -0.0209 View CSV PDB
LE326A 0.5293 -0.0268 View CSV PDB
FK327A 0.3866 -0.0125 View CSV PDB
LK326A 0.7279 -0.0207 View CSV PDB
 
Laboratory of Theory of Biopolymers 2018