Project name: c33004d113134dd

Status: done

Started: 2026-05-19 12:24:14
Settings
Chain sequence(s) A: MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREEAEAEAEPK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:02)
Show buried residues

Minimal score value
-4.7087
Maximal score value
4.0674
Average score
-0.1542
Total score value
-14.6464

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.4635
2 R A -0.3648
3 F A 1.3346
4 P A 1.2350
5 S A 1.3261
6 I A 2.8424
7 F A 3.7715
8 T A 2.9946
9 A A 2.9869
10 V A 4.0674
11 L A 3.9568
12 F A 3.7449
13 A A 2.4409
14 A A 2.0175
15 S A 1.7232
16 S A 1.1719
17 A A 1.0936
18 L A 1.6585
19 A A 0.9556
20 A A 0.7317
21 P A 0.4805
22 V A 1.0267
23 N A -0.5471
24 T A -1.0691
25 T A -1.1916
26 T A -2.2843
27 E A -3.2608
28 D A -3.5949
29 E A -3.5136
30 T A -1.8995
31 A A -1.0826
32 Q A -0.7306
33 I A 1.2159
34 P A 0.4479
35 A A 0.4777
36 E A -0.3629
37 A A 0.9905
38 V A 2.4968
39 I A 1.8366
40 G A 0.3691
41 Y A 1.5069
42 S A 0.2870
43 D A -1.6746
44 L A -1.1698
45 E A -2.6292
46 G A -1.7494
47 D A -1.7610
48 F A 0.5507
49 D A 0.4720
50 V A 1.1121
51 A A 1.7796
52 V A 3.0511
53 L A 2.7708
54 P A 1.9163
55 F A 1.6418
56 S A -0.6691
57 N A -1.8271
58 S A -1.4470
59 T A -1.4902
60 N A -2.2071
61 N A -1.6228
62 G A 0.3192
63 L A 2.8928
64 L A 3.2042
65 F A 3.3044
66 I A 2.2445
67 N A 0.9679
68 T A 1.2857
69 T A 1.3220
70 I A 2.3554
71 A A 0.9459
72 S A 0.3942
73 I A 0.9808
74 A A -0.1833
75 A A -1.0951
76 K A -2.3902
77 E A -2.4148
78 E A -2.6350
79 G A -1.8242
80 V A -1.6714
81 S A -1.3240
82 L A -1.1835
83 E A -3.1291
84 K A -3.7735
85 R A -3.6681
86 E A -4.5944
87 E A -4.7087
88 A A -3.8556
89 E A -4.3312
90 A A -3.6413
91 E A -3.9747
92 A A -3.0718
93 E A -3.3420
94 P A -2.3030
95 K A -2.5460
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018