Project name: mKRC2 - 1st cassette

Status: done

Started: 2026-07-28 08:19:15
Settings
Chain sequence(s) A: MDAMKRGLCCVLLLCGAVFVSPSQEIHARYRLEDIVTYHCSQGLVLRGSQKRKCYRGAMRGKLIVQCPIDPKNVPKYDLHESFSLVLGPDDPVEAVLGDVTTATTEEKLRPPNIPRFSSDFFYPKSLIRRDAHRQFRDYCAVCSRWEWPGAPKPLRKQDEYHMVHLLCASRSPPSSPKSETESHSNMRCTCWVIEDEDGAAAAAYPYDVPDYA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:00)
Show buried residues

Minimal score value
-4.1189
Maximal score value
3.4773
Average score
-0.6423
Total score value
-136.8058

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3333
2 D A -1.1871
3 A A -0.7781
4 M A -0.6835
5 K A -2.2391
6 R A -2.0630
7 G A -0.6458
8 L A 1.3836
9 C A 2.1533
10 C A 2.7977
11 V A 3.4773
12 L A 2.7578
13 L A 1.2491
14 L A 0.0985
15 C A 0.0000
16 G A -0.6979
17 A A -0.3733
18 V A 0.0000
19 F A 1.5124
20 V A 0.6676
21 S A -0.2440
22 P A -0.7004
23 S A -0.9187
24 Q A -1.5854
25 E A -1.6419
26 I A -0.6185
27 H A -1.4643
28 A A -1.5145
29 R A -2.2820
30 Y A -1.6554
31 R A -2.1224
32 L A -1.3940
33 E A -2.0753
34 D A -0.8781
35 I A 0.5000
36 V A 0.0294
37 T A -0.8497
38 Y A 0.0000
39 H A -1.1686
40 C A -0.4123
41 S A -0.4648
42 Q A -1.2398
43 G A -0.5322
44 L A 0.3727
45 V A 1.2099
46 L A -0.3130
47 R A -1.7859
48 G A -1.6190
49 S A -2.2509
50 Q A -2.8366
51 K A -2.6728
52 R A -1.9223
53 K A -1.6689
54 C A 0.0000
55 Y A -1.5591
56 R A -2.2199
57 G A -1.0687
58 A A -0.9780
59 M A -1.4086
60 R A -2.5122
61 G A -2.2907
62 K A -1.8878
63 L A 1.0163
64 I A 0.9007
65 V A 0.0000
66 Q A -0.0477
67 C A 0.2929
68 P A 0.4879
69 I A 1.1406
70 D A -0.4287
71 P A -0.9520
72 K A -2.0578
73 N A -1.7086
74 V A 0.0731
75 P A -0.6635
76 K A -1.2455
77 Y A 0.0392
78 D A -1.5267
79 L A 0.0499
80 H A -1.3223
81 E A -1.8599
82 S A 0.0076
83 F A 2.0652
84 S A 1.9028
85 L A 3.1928
86 V A 3.1987
87 L A 1.6042
88 G A -0.2858
89 P A -1.3106
90 D A -2.5506
91 D A -2.4311
92 P A -1.0586
93 V A 0.3089
94 E A -0.5626
95 A A 0.8276
96 V A 1.9605
97 L A 1.8312
98 G A 0.2852
99 D A -0.6550
100 V A 0.9377
101 T A 0.2255
102 T A 0.1620
103 A A -0.2651
104 T A -1.0605
105 T A -1.8025
106 E A -3.1581
107 E A -3.5241
108 K A -2.8230
109 L A -1.0484
110 R A -2.2735
111 P A -1.1250
112 P A -0.9132
113 N A -1.2010
114 I A 0.3369
115 P A -0.1611
116 R A -0.8576
117 F A 0.8171
118 S A 0.2822
119 S A -0.1887
120 D A -0.0038
121 F A 2.2703
122 F A 2.6483
123 Y A 2.5379
124 P A 0.7763
125 K A -0.9948
126 S A -1.0315
127 L A -0.3501
128 I A -0.3245
129 R A -2.7595
130 R A -3.2312
131 D A -3.1583
132 A A -2.3559
133 H A -3.4708
134 R A -4.1189
135 Q A -2.9554
136 F A -1.5007
137 R A -2.2577
138 D A -2.1021
139 Y A 0.2364
140 C A 0.6101
141 A A 0.7154
142 V A 1.4981
143 C A 0.0000
144 S A -0.6515
145 R A -1.8770
146 W A -1.3299
147 E A -1.6896
148 W A -0.1605
149 P A -0.3854
150 G A -0.7929
151 A A -0.5980
152 P A -0.8665
153 K A -1.8455
154 P A -1.0595
155 L A -0.8617
156 R A -2.9783
157 K A -3.2703
158 Q A -2.8930
159 D A -1.8322
160 E A -2.1562
161 Y A 0.1403
162 H A -0.1834
163 M A 1.4805
164 V A 2.2678
165 H A 1.0842
166 L A 1.7125
167 L A 1.4819
168 C A 0.5376
169 A A -0.0322
170 S A -1.1877
171 R A -2.2591
172 S A -1.4927
173 P A -1.0783
174 P A -0.8450
175 S A -0.8575
176 S A -0.9071
177 P A -1.5111
178 K A -2.3914
179 S A -2.1916
180 E A -2.7981
181 T A -2.2517
182 E A -2.6924
183 S A -2.0653
184 H A -1.9214
185 S A -1.6855
186 N A -1.8343
187 M A -1.2415
188 R A -2.1290
189 C A -1.1310
190 T A -0.1394
191 C A 1.2422
192 W A 2.0301
193 V A 2.3321
194 I A 0.7281
195 E A -1.8365
196 D A -3.2055
197 E A -3.9954
198 D A -3.5137
199 G A -2.2093
200 A A -1.3171
201 A A -0.8316
202 A A -0.5819
203 A A 0.4628
204 A A 1.2113
205 Y A 1.3579
206 P A 0.7690
207 Y A 1.1458
208 D A -0.4686
209 V A 0.8790
210 P A -0.1571
211 D A -1.0029
212 Y A 0.6586
213 A A 0.1932
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018