Project name: query_structure

Status: done

Started: 2026-03-16 20:38:15
Settings
Chain sequence(s) A: LPAPKNLWSRVTEDSARLSWTAPDAAFDSFWIRYFEFTTAGEAIVLTVPGSERSYDLTGLKPGTEYWNIMGVKGGSISPPLSAIFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)
Show buried residues

Minimal score value
-2.8595
Maximal score value
2.3296
Average score
-0.4827
Total score value
-41.9927

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 1.0280
2 P A 0.1413
3 A A -0.1646
4 P A 0.0000
5 K A -1.7355
6 N A -1.4474
7 L A -0.3241
8 W A 0.1376
9 S A -0.5485
10 R A -1.9233
11 V A -1.3532
12 T A -1.6920
13 E A -2.8065
14 D A -2.8595
15 S A -2.2872
16 A A 0.0000
17 R A -1.9879
18 L A 0.0000
19 S A -0.8993
20 W A 0.0000
21 T A -1.2227
22 A A -1.3273
23 P A -1.3096
24 D A -2.2747
25 A A -1.4382
26 A A -1.0640
27 F A 0.0000
28 D A -2.6105
29 S A -1.1591
30 F A 0.0000
31 W A 0.6956
32 I A 0.0000
33 R A 0.0405
34 Y A 0.0000
35 F A 0.7445
36 E A 0.3102
37 F A 1.3922
38 T A 0.2469
39 T A -0.1579
40 A A -0.2443
41 G A -0.7662
42 E A -1.5015
43 A A -0.1810
44 I A 0.4953
45 V A 1.1983
46 L A 0.9164
47 T A 0.3426
48 V A 0.0000
49 P A -1.0990
50 G A 0.0000
51 S A -1.6305
52 E A -1.7399
53 R A -1.1404
54 S A -0.8640
55 Y A -1.0164
56 D A -2.0627
57 L A 0.0000
58 T A -1.4890
59 G A -1.5397
60 L A 0.0000
61 K A -2.2029
62 P A -1.7355
63 G A -0.6438
64 T A 0.7482
65 E A 0.0000
66 Y A 1.7665
67 W A 0.0000
68 N A 0.1980
69 I A 0.0000
70 M A 0.0000
71 G A 0.0000
72 V A -0.3124
73 K A -1.3338
74 G A -1.2912
75 G A -0.8764
76 S A -0.0839
77 I A 1.1902
78 S A 0.0000
79 P A 0.1316
80 P A -0.3348
81 L A -0.5391
82 S A 0.1573
83 A A 1.3565
84 I A 2.3296
85 F A 1.2053
86 T A 0.0254
87 T A -1.5693
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018