Project name: c419251040f19b7

Chain sequence(s)	A: EEVLRLVEELEATTAETDALIAAALPHVPADLRARFTAAYDAGIAKWKELAELVKEEKWEEAIELIEELIADMRNTSKPLVDAVVAALRAAGHDALADALAAQFARNLELGEKLLEALKK
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:19)

• Minimal score value: -4.3271
• Maximal score value: 0.0
• Average score: -1.6664
• Total score value: -199.9687

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.5575
2	E	A	-2.6929
3	V	A	-2.2488
4	L	A	-1.9862
5	R	A	-2.9412
6	L	A	0.0000
7	V	A	0.0000
8	E	A	-3.3429
9	E	A	-2.7915
10	L	A	0.0000
11	E	A	-3.1144
12	A	A	-1.9939
13	T	A	0.0000
14	T	A	-1.6420
15	A	A	-1.6081
16	E	A	-2.1150
17	T	A	0.0000
18	D	A	-1.5101
19	A	A	-0.9213
20	L	A	-0.4392
21	I	A	0.0000
22	A	A	-0.3929
23	A	A	-0.0730
24	A	A	0.0000
25	L	A	0.0000
26	P	A	-0.5359
27	H	A	-0.7927
28	V	A	0.0000
29	P	A	-0.9321
30	A	A	-1.4108
31	D	A	-2.3958
32	L	A	-1.6352
33	R	A	-1.7811
34	A	A	-1.6874
35	R	A	-2.3266
36	F	A	0.0000
37	T	A	-1.3051
38	A	A	-1.1426
39	A	A	-1.0179
40	Y	A	-0.9894
41	D	A	-1.6302
42	A	A	-0.9221
43	G	A	-1.3671
44	I	A	-1.2819
45	A	A	-1.5615
46	K	A	-2.2310
47	W	A	0.0000
48	K	A	-3.3114
49	E	A	-3.6631
50	L	A	0.0000
51	A	A	-3.3504
52	E	A	-4.3271
53	L	A	-3.8140
54	V	A	0.0000
55	K	A	-3.9429
56	E	A	-4.1689
57	E	A	-4.1742
58	K	A	-3.5020
59	W	A	-2.7969
60	E	A	-3.3286
61	E	A	-3.4606
62	A	A	0.0000
63	I	A	-2.7674
64	E	A	-3.4516
65	L	A	-2.7187
66	I	A	0.0000
67	E	A	-3.4070
68	E	A	-3.4859
69	L	A	0.0000
70	I	A	0.0000
71	A	A	-2.4759
72	D	A	-2.8535
73	M	A	-2.2598
74	R	A	-3.2029
75	N	A	-2.7306
76	T	A	-1.7374
77	S	A	-1.7835
78	K	A	-2.2018
79	P	A	-1.4916
80	L	A	-1.0356
81	V	A	0.0000
82	D	A	-1.3470
83	A	A	-0.7536
84	V	A	0.0000
85	V	A	-1.1028
86	A	A	-0.8252
87	A	A	-0.8021
88	L	A	0.0000
89	R	A	-2.1951
90	A	A	-0.9579
91	A	A	-0.9713
92	G	A	-1.5682
93	H	A	-2.0303
94	D	A	-2.8582
95	A	A	-1.6643
96	L	A	-1.1867
97	A	A	0.0000
98	D	A	-2.3256
99	A	A	-0.9073
100	L	A	0.0000
101	A	A	-0.9786
102	A	A	-0.8339
103	Q	A	0.0000
104	F	A	-0.8369
105	A	A	-1.2594
106	R	A	-2.4635
107	N	A	-1.9973
108	L	A	-2.1024
109	E	A	-3.0684
110	L	A	-2.4050
111	G	A	0.0000
112	E	A	-3.3998
113	K	A	-3.1470
114	L	A	0.0000
115	L	A	-2.7983
116	E	A	-3.3976
117	A	A	-2.7972
118	L	A	0.0000
119	K	A	-3.3226
120	K	A	-2.9046