Project name: query_structure

Status: done

Started: 2026-03-16 21:21:01
Settings
Chain sequence(s) A: MIPGGLTEAKPATIEIQEIANMVKPQLEEKTNETYEEFTAIEYKSQVVAGINYYIKIQTGDNRYIHIKVFKSLPQQSHSLILTGYQVDKTKDDELAGF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:08)
Show buried residues

Minimal score value
-3.8254
Maximal score value
2.4481
Average score
-0.7442
Total score value
-72.9346

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 2.0441
2 I A 2.4481
3 P A 1.2920
4 G A 0.7741
5 G A 0.6784
6 L A 0.2702
7 T A -0.3675
8 E A -2.0588
9 A A -1.7763
10 K A -1.6545
11 P A -0.6075
12 A A -0.4585
13 T A -0.0893
14 I A 0.6873
15 E A -1.4002
16 I A 0.0000
17 Q A -0.6908
18 E A -1.4204
19 I A 0.0000
20 A A 0.0000
21 N A -0.9247
22 M A 0.3777
23 V A 0.0000
24 K A -1.1314
25 P A -1.4929
26 Q A -1.6389
27 L A 0.0000
28 E A -3.0616
29 E A -3.8254
30 K A -3.4528
31 T A -2.6241
32 N A -3.3687
33 E A -3.2873
34 T A -2.1887
35 Y A 0.0000
36 E A -2.6006
37 E A -2.5549
38 F A 0.0000
39 T A -0.7995
40 A A 0.0000
41 I A -0.1513
42 E A -1.1775
43 Y A 0.0000
44 K A -1.0493
45 S A -0.0390
46 Q A 1.1016
47 V A 2.0355
48 V A 1.5695
49 A A 0.9051
50 G A 0.0000
51 I A 1.2187
52 N A 0.6627
53 Y A 0.2003
54 Y A 0.0000
55 I A 0.0000
56 K A 0.0000
57 I A 0.0000
58 Q A -1.8310
59 T A 0.0000
60 G A -2.5781
61 D A -3.0923
62 N A -3.7235
63 R A -3.6202
64 Y A 0.0000
65 I A 0.0000
66 H A 0.0000
67 I A 0.0000
68 K A 0.0546
69 V A 0.0000
70 F A 0.8360
71 K A 0.0319
72 S A -0.4298
73 L A -0.5409
74 P A -1.3327
75 Q A -1.7880
76 Q A -1.7464
77 S A -1.3617
78 H A -1.5318
79 S A -0.5220
80 L A 0.5185
81 I A 0.8967
82 L A 0.0000
83 T A 0.3447
84 G A 0.1341
85 Y A 0.2423
86 Q A -0.2629
87 V A -0.4293
88 D A -2.2293
89 K A -2.7342
90 T A -3.3507
91 K A -3.6106
92 D A -3.5833
93 D A -3.2246
94 E A -3.0310
95 L A 0.0000
96 A A -0.6429
97 G A -0.0786
98 F A 0.9095
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018