Project name: query_structure

Status: done

Started: 2026-03-17 00:18:17
Settings
Chain sequence(s) A: QLVESGGGLVQAGDSLRLSCAASERALSSFHMGWFRQAPGKQRAFVAAIKWRDGTTYYADSVKGRFTISRDNAKNTVYLQMNSLEPEDTAVYYCYYRGRWGTYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:25)
Show buried residues

Minimal score value
-2.9171
Maximal score value
1.0563
Average score
-0.8614
Total score value
-98.2007

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.2103
2 L A 0.0000
3 V A 0.6987
4 E A 0.0000
5 S A -0.5198
6 G A -0.9897
7 G A -0.8049
8 G A -0.0615
9 L A 1.0563
10 V A -0.1657
11 Q A -1.4867
12 A A -1.7435
13 G A -1.7255
14 D A -1.7794
15 S A -1.5815
16 L A -1.1770
17 R A -2.0961
18 L A 0.0000
19 S A -0.4471
20 C A 0.0000
21 A A -0.4722
22 A A -1.2364
23 S A -1.5934
24 E A -2.9171
25 R A -2.8555
26 A A -1.8221
27 L A 0.0000
28 S A -1.2241
29 S A -1.0881
30 F A -0.7918
31 H A -0.8927
32 M A 0.0000
33 G A 0.0000
34 W A 0.0000
35 F A 0.2413
36 R A -0.7280
37 Q A -1.5402
38 A A -1.7744
39 P A -1.3189
40 G A -1.7926
41 K A -2.8699
42 Q A -2.5331
43 R A -1.6759
44 A A -0.5833
45 F A 0.3835
46 V A 0.0000
47 A A 0.0000
48 A A 0.0000
49 I A 0.0000
50 K A -1.6062
51 W A -1.4532
52 R A -2.7698
53 D A -2.8307
54 G A -1.7240
55 T A -1.0429
56 T A -0.0409
57 Y A 0.4299
58 Y A -0.2820
59 A A -0.9063
60 D A -2.2899
61 S A -1.7397
62 V A 0.0000
63 K A -2.4984
64 G A -1.7603
65 R A -1.4673
66 F A 0.0000
67 T A -0.7378
68 I A 0.0000
69 S A -0.5861
70 R A -1.1610
71 D A -1.8374
72 N A -2.1673
73 A A -1.5903
74 K A -2.3938
75 N A -2.4244
76 T A 0.0000
77 V A 0.0000
78 Y A -0.6324
79 L A 0.0000
80 Q A -1.1987
81 M A 0.0000
82 N A -1.5906
83 S A -1.4816
84 L A 0.0000
85 E A -2.5498
86 P A -1.9263
87 E A -2.3513
88 D A 0.0000
89 T A -0.9713
90 A A 0.0000
91 V A -0.5955
92 Y A 0.0000
93 Y A 0.0174
94 C A 0.0000
95 Y A 0.0000
96 Y A -0.4463
97 R A -1.0825
98 G A -1.0047
99 R A -1.5587
100 W A 0.0564
101 G A -0.2315
102 T A -0.0700
103 Y A 0.7181
104 W A 0.6275
105 G A 0.0395
106 Q A -0.8732
107 G A 0.0000
108 T A 0.0000
109 Q A -1.0643
110 V A 0.0000
111 T A -0.3080
112 V A 0.0000
113 S A -0.8542
114 S A -0.8703
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018