Project name: query_structure

Status: done

Started: 2026-03-17 01:22:25
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGYAGVQEFEVPGSKSTATISGLSPGVDYTITVYAYTQYENIGVGYQSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:54)
Show buried residues

Minimal score value
-2.6831
Maximal score value
1.8077
Average score
-0.3996
Total score value
-37.9627

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8077
2 S A 0.8443
3 S A 0.6650
4 V A 0.3278
5 P A 0.0000
6 T A -1.6219
7 K A -2.6371
8 L A 0.0000
9 E A -1.9456
10 V A 0.0765
11 V A 1.5192
12 A A 0.8869
13 A A 0.2969
14 T A -0.3833
15 P A -0.8023
16 T A -0.5316
17 S A -0.3206
18 L A 0.0000
19 L A 0.7286
20 I A 0.0000
21 S A -0.9859
22 W A 0.0000
23 D A -2.6831
24 A A -1.2128
25 P A 0.0439
26 A A 0.4470
27 V A 0.6632
28 T A -0.1114
29 V A -0.5020
30 D A -1.0776
31 H A -1.4647
32 Y A 0.0000
33 V A 0.0000
34 I A 0.0000
35 T A -0.7123
36 Y A -0.2825
37 G A 0.0000
38 E A -0.8633
39 T A -0.8469
40 G A -0.5896
41 G A 0.0119
42 Y A 1.1837
43 A A 0.4930
44 G A 0.1847
45 V A 0.7952
46 Q A -0.8836
47 E A -1.9147
48 F A -1.4271
49 E A -2.0012
50 V A 0.0000
51 P A -1.4613
52 G A -1.3812
53 S A -1.2748
54 K A -2.0504
55 S A -1.4565
56 T A -0.7685
57 A A 0.0000
58 T A 0.2883
59 I A 0.0000
60 S A -0.4746
61 G A -0.6877
62 L A 0.0000
63 S A -0.8463
64 P A -0.9892
65 G A -1.0756
66 V A -0.9060
67 D A -1.8894
68 Y A 0.0000
69 T A -0.7430
70 I A 0.0000
71 T A -0.1114
72 V A 0.0000
73 Y A -0.3588
74 A A 0.0000
75 Y A -0.1411
76 T A -0.2258
77 Q A -0.6985
78 Y A 0.2348
79 E A -1.5741
80 N A -0.9135
81 I A 1.3212
82 G A 0.7446
83 V A 1.4337
84 G A 0.9217
85 Y A 0.7041
86 Q A -0.4888
87 S A -0.2280
88 P A -0.1479
89 I A -0.0230
90 S A -0.3537
91 I A -0.7161
92 N A -1.7525
93 Y A -1.4815
94 R A -2.3710
95 T A -1.1953
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018