Project name: rKAP1

Status: done

Started: 2026-07-08 06:06:44
Settings
Chain sequence(s) A: MSYNCCSRNFSSRSCGGYLHYPASSCGFSYPSNLVYSTDLCSPSTCQLGSSLYRGCQEQTSCYRPRTSLLCSPCQTTYSGSLGFGSSSCRSLGYGSRSCYVGCGSSG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)
Show buried residues

Minimal score value
-2.6423
Maximal score value
2.4952
Average score
0.0478
Total score value
5.118

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.1361
2 S A 0.6417
3 Y A 1.2659
4 N A -0.0137
5 C A 0.8492
6 C A 0.2826
7 S A -0.9903
8 R A -2.2301
9 N A -1.5189
10 F A 0.9602
11 S A -0.0136
12 S A -0.3405
13 R A -1.5456
14 S A -0.3268
15 C A 0.3344
16 G A -0.1277
17 G A 0.2806
18 Y A 1.3445
19 L A 1.0877
20 H A 0.6665
21 Y A 1.3526
22 P A 0.5451
23 A A 0.1227
24 S A 0.3847
25 S A 0.4217
26 C A 0.7727
27 G A 0.8564
28 F A 2.0097
29 S A 1.3208
30 Y A 1.4320
31 P A 0.6487
32 S A -0.1728
33 N A -0.4487
34 L A 0.9727
35 V A 1.0478
36 Y A 1.3032
37 S A 0.6449
38 T A 0.1518
39 D A -0.5866
40 L A 1.1775
41 C A 0.7843
42 S A -0.3346
43 P A -0.0960
44 S A -0.2624
45 T A -0.5763
46 C A 0.0425
47 Q A -0.7400
48 L A 0.0201
49 G A 0.0028
50 S A 0.1387
51 S A 0.6401
52 L A 1.5796
53 Y A 1.0693
54 R A -0.8824
55 G A -0.6644
56 C A -0.8906
57 Q A -2.4144
58 E A -2.6423
59 Q A -2.0200
60 T A -1.1023
61 S A -0.4965
62 C A -0.0107
63 Y A -0.1592
64 R A -1.7456
65 P A -1.4984
66 R A -2.0955
67 T A -0.6632
68 S A 0.5946
69 L A 2.1244
70 L A 2.4952
71 C A 1.5336
72 S A 0.7785
73 P A 0.2531
74 C A 0.3747
75 Q A -0.4839
76 T A 0.0365
77 T A -0.0666
78 Y A 0.0393
79 S A -0.4371
80 G A -0.6378
81 S A 0.0486
82 L A 0.8957
83 G A 1.0185
84 F A 1.8462
85 G A 0.4892
86 S A -0.2592
87 S A -0.3690
88 S A 0.1421
89 C A -0.1698
90 R A -1.4728
91 S A 0.0000
92 L A 0.1736
93 G A -0.5145
94 Y A -0.4510
95 G A -0.6710
96 S A -1.5245
97 R A -1.6577
98 S A -0.5390
99 C A 0.7575
100 Y A 1.4007
101 V A 0.5031
102 G A 0.0000
103 C A 0.0711
104 G A -0.1298
105 S A -0.2876
106 S A -0.7983
107 G A -0.6703
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018