Project name: c5b9232f7411425

Chain sequence(s)	A: QVQLVESGGGSVQAGGSLRLSCTASGDESHHYAGFSLGWFRQAPGQEREAVAAIYRGGGSTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAAGSGYISHEYWGQGTQVTVSGGGGSHHHHHHLEVSGWRLFKKIS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:11)

• Minimal score value: -3.583
• Maximal score value: 1.8319
• Average score: -0.9093
• Total score value: -131.8532

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-2.5078
2	V	A	0.0000
3	Q	A	-1.6540
4	L	A	0.0000
5	V	A	1.1957
6	E	A	0.0000
7	S	A	-0.4648
8	G	A	-1.2773
9	G	A	-1.1623
10	G	A	-0.9371
11	S	A	-0.7673
12	V	A	-0.9428
13	Q	A	-2.0555
14	A	A	-2.1919
15	G	A	-1.9266
16	G	A	-1.4258
17	S	A	-1.4415
18	L	A	-1.1995
19	R	A	-2.1133
20	L	A	0.0000
21	S	A	-0.4649
22	C	A	0.0000
23	T	A	-0.2054
24	A	A	0.0000
25	S	A	-1.5813
26	G	A	-2.3864
27	D	A	-3.2329
28	E	A	-3.0565
29	S	A	-2.4802
30	H	A	-2.3060
31	H	A	-2.0264
32	Y	A	0.0000
33	A	A	-1.3261
34	G	A	-1.2379
35	F	A	0.0000
36	S	A	-0.5829
37	L	A	0.0000
38	G	A	0.0000
39	W	A	0.0000
40	F	A	-0.2027
41	R	A	0.0000
42	Q	A	-2.1355
43	A	A	-1.9498
44	P	A	-1.2683
45	G	A	-1.7485
46	Q	A	-2.9717
47	E	A	-3.5830
48	R	A	-3.1064
49	E	A	-2.4226
50	A	A	-0.5636
51	V	A	0.0000
52	A	A	0.0000
53	A	A	0.4237
54	I	A	0.0000
55	Y	A	0.1121
56	R	A	-1.8074
57	G	A	-1.4276
58	G	A	-1.1491
59	G	A	-0.8685
60	S	A	-0.3206
61	T	A	0.2243
62	Y	A	0.5772
63	Y	A	-0.4985
64	A	A	-1.1876
65	D	A	-2.3477
66	S	A	-1.7461
67	V	A	0.0000
68	K	A	-2.4914
69	G	A	-1.8492
70	R	A	-1.5685
71	F	A	0.0000
72	T	A	-0.7086
73	I	A	0.0000
74	S	A	-0.5593
75	R	A	-1.2427
76	D	A	-1.7373
77	N	A	-2.2154
78	A	A	-1.5163
79	K	A	-2.2943
80	N	A	-1.8780
81	T	A	-1.0124
82	V	A	0.0000
83	T	A	-0.7747
84	L	A	0.0000
85	Q	A	-1.1393
86	M	A	0.0000
87	N	A	-1.7989
88	N	A	-2.2506
89	L	A	0.0000
90	K	A	-2.5843
91	P	A	-1.9865
92	E	A	-2.3384
93	D	A	0.0000
94	T	A	-1.1194
95	A	A	0.0000
96	I	A	-0.4614
97	Y	A	0.0000
98	Y	A	-0.0683
99	C	A	0.0000
100	A	A	0.0000
101	A	A	0.0000
102	A	A	-1.0080
103	G	A	-0.9504
104	S	A	-0.4062
105	G	A	0.5033
106	Y	A	1.8182
107	I	A	1.8319
108	S	A	-0.0391
109	H	A	-1.3700
110	E	A	-2.0072
111	Y	A	0.0000
112	W	A	-0.2237
113	G	A	-0.0743
114	Q	A	-0.7821
115	G	A	0.0000
116	T	A	-0.6208
117	Q	A	-1.2599
118	V	A	0.0000
119	T	A	-1.0250
120	V	A	0.0000
121	S	A	-1.5653
122	G	A	-1.8156
123	G	A	-1.6962
124	G	A	-1.5473
125	G	A	-1.4642
126	S	A	-1.6183
127	H	A	-2.2729
128	H	A	-2.5534
129	H	A	-2.7675
130	H	A	-2.4909
131	H	A	-2.2083
132	H	A	-1.5275
133	L	A	0.2258
134	E	A	-0.8907
135	V	A	1.1349
136	S	A	-0.0062
137	G	A	-0.2183
138	W	A	1.0816
139	R	A	-0.3853
140	L	A	1.1518
141	F	A	1.2919
142	K	A	-0.8271
143	K	A	-0.8415
144	I	A	0.8778
145	S	A	0.0146