Project name: c625f025b2aa67f

Status: done

Started: 2026-07-24 15:20:07
Settings
Chain sequence(s) A: EEKEKEEEERKKELEEEKKEEEEEEKAANKYKIEHKEEIEKLKEELTRDPNEVDWVPRPLRRQPSIRIKI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:41)
Show buried residues

Minimal score value
-7.58
Maximal score value
1.5153
Average score
-3.6476
Total score value
-255.3313

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -4.4564
2 E A -5.4761
3 K A -5.6937
4 E A -6.3000
5 K A -6.8102
6 E A -6.9160
7 E A -6.7501
8 E A -6.8823
9 E A -6.8030
10 R A -6.4466
11 K A -6.3872
12 K A -6.6533
13 E A -6.3660
14 L A -5.1064
15 E A -6.3167
16 E A -6.9603
17 E A -6.8253
18 K A -6.9350
19 K A -7.3690
20 E A -7.5621
21 E A -7.5800
22 E A -7.2278
23 E A -6.8535
24 E A -6.4541
25 E A -5.9161
26 K A -5.1809
27 A A -3.5790
28 A A -2.8437
29 N A -3.0723
30 K A -2.7356
31 Y A -1.0881
32 K A -2.3255
33 I A -0.7763
34 E A -2.2980
35 H A -2.9198
36 K A -3.2952
37 E A -4.3918
38 E A -4.3602
39 I A -3.4700
40 E A -4.7816
41 K A -4.6823
42 L A -2.7768
43 K A -3.6923
44 E A -4.2189
45 E A -3.4896
46 L A -1.3330
47 T A -2.1857
48 R A -4.1695
49 D A -3.7912
50 P A -2.7139
51 N A -2.8195
52 E A -2.7199
53 V A -0.0444
54 D A -0.4740
55 W A 1.1137
56 V A 1.5153
57 P A -0.0902
58 R A -1.3631
59 P A -0.7444
60 L A -0.4971
61 R A -2.6239
62 R A -3.0697
63 Q A -2.3103
64 P A -1.2525
65 S A -0.2680
66 I A 1.0746
67 R A -0.1301
68 I A 1.2102
69 K A -0.0218
70 I A 1.4022
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018