Project name: c6448814381fd02

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKALEWVSSIGSDGSNTHYTDSVKGRFTISRDNAKNTLYLQMNSLKSEDTARYFCYPGNTVGPSSPPGQG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)

• Minimal score value: -2.7993
• Maximal score value: 1.3307
• Average score: -0.8141
• Total score value: -90.3701

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.6396
2	V	A	-0.2940
3	Q	A	-0.5224
4	L	A	0.5701
5	V	A	1.3307
6	E	A	0.0559
7	S	A	-0.5871
8	G	A	-1.3204
9	G	A	-1.1129
10	G	A	-0.0926
11	L	A	1.2824
12	V	A	0.3949
13	Q	A	-1.0712
14	P	A	-1.5189
15	G	A	-1.3195
16	G	A	-0.7619
17	S	A	-1.0654
18	L	A	-0.7625
19	R	A	-1.8505
20	L	A	0.0000
21	S	A	-0.4485
22	C	A	0.0000
23	A	A	-0.1310
24	A	A	0.0000
25	S	A	-0.6199
26	G	A	-0.8262
27	F	A	-0.4258
28	T	A	-0.4320
29	F	A	0.0000
30	S	A	-1.6092
31	N	A	-1.6950
32	Y	A	-1.0496
33	A	A	-1.1268
34	M	A	0.0000
35	S	A	-0.1546
36	W	A	0.0000
37	V	A	0.2850
38	R	A	0.0000
39	Q	A	-1.0917
40	A	A	-1.6459
41	P	A	-1.2933
42	G	A	-1.3258
43	K	A	-1.8540
44	A	A	-0.4437
45	L	A	0.4918
46	E	A	-0.0863
47	W	A	0.3433
48	V	A	0.0000
49	S	A	0.0000
50	S	A	-0.6192
51	I	A	0.0000
52	G	A	-1.5979
53	S	A	-1.7427
54	D	A	-2.5868
55	G	A	-1.8163
56	S	A	-1.5533
57	N	A	-2.0316
58	T	A	-1.2618
59	H	A	-1.6853
60	Y	A	-1.4588
61	T	A	-1.5846
62	D	A	-2.6404
63	S	A	-1.8284
64	V	A	0.0000
65	K	A	-2.7993
66	G	A	-1.7926
67	R	A	-1.5413
68	F	A	0.0000
69	T	A	-0.9400
70	I	A	0.0000
71	S	A	-0.5924
72	R	A	-1.3065
73	D	A	-1.8281
74	N	A	-2.0543
75	A	A	-1.3647
76	K	A	-2.2910
77	N	A	-1.6846
78	T	A	-1.0164
79	L	A	0.0000
80	Y	A	-0.5920
81	L	A	0.0000
82	Q	A	-1.0666
83	M	A	0.0000
84	N	A	-1.4032
85	S	A	-1.1914
86	L	A	0.0000
87	K	A	-2.2462
88	S	A	-1.8859
89	E	A	-2.3569
90	D	A	0.0000
91	T	A	-1.1808
92	A	A	-1.6227
93	R	A	-1.7405
94	Y	A	-0.7066
95	F	A	0.2450
96	C	A	0.0000
97	Y	A	0.0994
98	P	A	0.0000
99	G	A	-0.7121
100	N	A	-1.1434
101	T	A	0.2087
102	V	A	1.1986
103	G	A	0.2759
104	P	A	-0.0900
105	S	A	-0.2716
106	S	A	-0.7208
107	P	A	-0.8868
108	P	A	-1.0970
109	G	A	-1.4302
110	Q	A	-1.7554
111	G	A	-1.2552