Project name: c68014be10cd137

Chain sequence(s)	A: GADLALVGVHRIDLSDPADIARLRADMARIAAGSLATAAAAAAAGYTVRWMGLVIRPRGQPPRWIGLDAVPASAEELRALIDAALAADFAAPPASAAMPAALRAAVEAVAADLPSPTLLVFVDGELAVAVPGLPSPAALVAAL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:45)

• Minimal score value: -2.8905
• Maximal score value: 0.898
• Average score: -0.5518
• Total score value: -78.9055

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-0.8509
2	A	A	-1.1423
3	D	A	-1.7015
4	L	A	0.0000
5	A	A	0.0000
6	L	A	0.0000
7	V	A	0.0000
8	G	A	0.1198
9	V	A	0.0000
10	H	A	0.0000
11	R	A	-2.3889
12	I	A	-1.7232
13	D	A	-1.6006
14	L	A	-1.2748
15	S	A	-1.0129
16	D	A	-1.1508
17	P	A	-0.9107
18	A	A	-0.9963
19	D	A	-1.5835
20	I	A	-0.9213
21	A	A	-1.2589
22	R	A	-2.1779
23	L	A	0.0000
24	R	A	-1.7259
25	A	A	-1.2139
26	D	A	0.0000
27	M	A	0.0000
28	A	A	-1.4486
29	R	A	-1.7538
30	I	A	-0.7496
31	A	A	0.0000
32	A	A	-0.7656
33	G	A	-0.2938
34	S	A	0.0866
35	L	A	0.2675
36	A	A	0.1501
37	T	A	0.0000
38	A	A	0.0000
39	A	A	0.3001
40	A	A	0.1647
41	A	A	0.0000
42	A	A	-0.0298
43	A	A	0.0437
44	A	A	-0.0092
45	G	A	-0.4970
46	Y	A	-0.3215
47	T	A	-0.7273
48	V	A	-0.8118
49	R	A	-2.0713
50	W	A	0.0000
51	M	A	0.0000
52	G	A	-0.1754
53	L	A	0.0000
54	V	A	0.0000
55	I	A	0.0000
56	R	A	-2.2090
57	P	A	0.0000
58	R	A	-2.8905
59	G	A	-2.0067
60	Q	A	-2.0524
61	P	A	-1.3467
62	P	A	-1.4193
63	R	A	-0.9106
64	W	A	0.0000
65	I	A	0.2363
66	G	A	-0.1073
67	L	A	-0.4640
68	D	A	-1.8405
69	A	A	-0.6555
70	V	A	0.4346
71	P	A	0.0000
72	A	A	-0.2412
73	S	A	-0.9886
74	A	A	-1.6339
75	E	A	-2.6691
76	E	A	-2.2959
77	L	A	0.0000
78	R	A	-2.3679
79	A	A	-1.3188
80	L	A	-0.3340
81	I	A	0.0000
82	D	A	-1.2320
83	A	A	-0.4332
84	A	A	-0.5316
85	L	A	0.0000
86	A	A	-0.6025
87	A	A	-0.8636
88	D	A	-1.8227
89	F	A	0.0000
90	A	A	-0.6240
91	A	A	-0.3764
92	P	A	-0.2469
93	P	A	-0.1680
94	A	A	-0.1157
95	S	A	0.0000
96	A	A	-0.0899
97	A	A	-0.2520
98	M	A	0.0000
99	P	A	-0.3687
100	A	A	-0.1417
101	A	A	-0.4779
102	L	A	0.0000
103	R	A	-0.6901
104	A	A	-0.2916
105	A	A	-0.4277
106	V	A	0.0000
107	E	A	-0.5805
108	A	A	-0.1954
109	V	A	0.1875
110	A	A	0.0000
111	A	A	-1.0445
112	D	A	-1.5254
113	L	A	-0.8008
114	P	A	-0.8761
115	S	A	-1.0191
116	P	A	-0.3843
117	T	A	0.0000
118	L	A	0.4191
119	L	A	0.0000
120	V	A	0.0000
121	F	A	0.0000
122	V	A	-1.3230
123	D	A	-2.7880
124	G	A	-2.1699
125	E	A	-2.1935
126	L	A	-0.5109
127	A	A	-0.0563
128	V	A	0.6372
129	A	A	0.5582
130	V	A	0.4381
131	P	A	0.0730
132	G	A	0.0119
133	L	A	0.3983
134	P	A	0.1121
135	S	A	0.0254
136	P	A	0.1126
137	A	A	0.1008
138	A	A	0.1698
139	L	A	0.0000
140	V	A	0.4836
141	A	A	0.3827
142	A	A	0.5476
143	L	A	0.8980