Project name: c70398f4fa539f0

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWFRQAPGKGRELVAAISSSGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCARLRGGRLDEATADYWGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:11)

• Minimal score value: -3.2119
• Maximal score value: 0.9622
• Average score: -0.9197
• Total score value: -112.2015

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.0700
2	V	A	-1.0291
3	Q	A	-1.3357
4	L	A	0.0000
5	V	A	0.3129
6	E	A	0.0000
7	S	A	-0.7033
8	G	A	-0.9502
9	G	A	-0.7560
10	G	A	-0.0574
11	L	A	0.9622
12	V	A	-0.0784
13	Q	A	-1.3752
14	P	A	-1.6781
15	G	A	-1.4804
16	G	A	-0.9917
17	S	A	-1.0898
18	L	A	-0.9521
19	R	A	-2.0485
20	L	A	0.0000
21	S	A	-0.4622
22	C	A	0.0000
23	A	A	-0.4078
24	A	A	0.0000
25	S	A	-1.0946
26	G	A	-1.1860
27	F	A	-0.5443
28	T	A	-0.2465
29	F	A	0.0000
30	S	A	-0.6684
31	S	A	-0.1827
32	Y	A	-0.1664
33	A	A	-0.5011
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	0.0000
39	Q	A	-1.9041
40	A	A	-1.7696
41	P	A	-1.2218
42	G	A	-1.6853
43	K	A	-2.7941
44	G	A	-2.4414
45	R	A	-2.4970
46	E	A	-2.2940
47	L	A	-1.1231
48	V	A	0.0000
49	A	A	0.0000
50	A	A	0.0000
51	I	A	0.0000
52	S	A	-0.6634
53	S	A	-0.4604
54	S	A	-0.7319
55	G	A	-0.9232
56	G	A	-0.7896
57	S	A	-0.4859
58	T	A	-0.2652
59	Y	A	-0.8684
60	Y	A	-1.0778
61	P	A	-1.7261
62	D	A	-2.5556
63	S	A	-1.8020
64	V	A	0.0000
65	E	A	-2.7060
66	G	A	-1.8182
67	R	A	-1.4735
68	F	A	0.0000
69	T	A	-0.8182
70	I	A	0.0000
71	S	A	-0.5207
72	R	A	-1.1365
73	D	A	-1.7612
74	N	A	-1.8701
75	A	A	-1.5297
76	K	A	-2.4974
77	R	A	-2.1898
78	M	A	-1.1644
79	V	A	0.0000
80	Y	A	-0.5382
81	L	A	0.0000
82	Q	A	-1.1902
83	M	A	0.0000
84	N	A	-1.3751
85	S	A	-1.2824
86	L	A	0.0000
87	R	A	-2.6127
88	A	A	-1.9051
89	E	A	-2.3709
90	D	A	0.0000
91	T	A	-0.9064
92	A	A	0.0000
93	V	A	-0.5012
94	Y	A	0.0000
95	Y	A	-0.3682
96	C	A	0.0000
97	A	A	0.0000
98	R	A	0.0000
99	L	A	0.0000
100	R	A	-2.4350
101	G	A	-2.2389
102	G	A	-2.4432
103	R	A	-3.2119
104	L	A	-2.1993
105	D	A	-2.4871
106	E	A	-3.0282
107	A	A	-2.2384
108	T	A	-1.7080
109	A	A	-0.8480
110	D	A	-1.0733
111	Y	A	0.1166
112	W	A	0.3055
113	G	A	-0.1576
114	Q	A	-1.0076
115	G	A	-0.6138
116	T	A	-0.7833
117	Q	A	-0.9809
118	V	A	0.0000
119	T	A	-0.3516
120	V	A	0.0000
121	S	A	-0.8353
122	S	A	-0.5854