Project name: query_structure

Status: done

Started: 2026-03-17 00:52:14
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLTLSCAASGRTFSSSAMGWFRQAPGKEREFVAGISSSGGTTYYADPVEGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAVLGTYYGFPSSPTGYNYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:07)
Show buried residues

Minimal score value
-3.2585
Maximal score value
1.821
Average score
-0.5498
Total score value
-69.2704

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.8450
2 V A 0.0000
3 Q A -1.2485
4 L A 0.0000
5 V A 1.1427
6 E A 0.1040
7 S A -0.1910
8 G A -0.4677
9 G A -0.4700
10 G A 0.1406
11 L A 1.0684
12 V A 0.0793
13 Q A -1.1703
14 A A -1.3439
15 G A -1.2818
16 G A -0.8786
17 S A -0.8017
18 L A -0.1332
19 T A -0.2389
20 L A 0.0000
21 S A 0.1445
22 C A 0.0000
23 A A -0.1480
24 A A 0.0000
25 S A -1.3801
26 G A -2.0900
27 R A -2.5106
28 T A -1.3901
29 F A 0.0000
30 S A -1.3518
31 S A -0.7157
32 S A 0.0000
33 A A 0.0000
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A 0.0000
39 Q A -1.7930
40 A A -1.8187
41 P A -1.3351
42 G A -1.9007
43 K A -3.1480
44 E A -3.2585
45 R A -2.2381
46 E A -1.4461
47 F A -0.4729
48 V A 0.0000
49 A A 0.0000
50 G A 0.0000
51 I A 0.0000
52 S A 0.1339
53 S A -0.2804
54 S A -0.7608
55 G A -0.8296
56 G A -0.7167
57 T A -0.0091
58 T A 0.4681
59 Y A 0.9086
60 Y A -0.3431
61 A A -1.1466
62 D A -2.3828
63 P A -1.9246
64 V A 0.0000
65 E A -2.5926
66 G A -1.8394
67 R A -1.4904
68 F A 0.0000
69 T A -0.4432
70 I A 0.0000
71 S A -0.4000
72 R A -1.0180
73 D A -1.5950
74 N A -1.9264
75 A A -1.5044
76 K A -2.4021
77 N A -2.1682
78 T A 0.0000
79 V A 0.0000
80 Y A 0.1159
81 L A 0.0000
82 Q A -0.4179
83 M A 0.0000
84 N A -1.0904
85 S A -1.1501
86 L A 0.0000
87 K A -2.0285
88 P A -1.6870
89 E A -2.2032
90 D A 0.0000
91 T A -0.8069
92 A A 0.0000
93 V A -0.3874
94 Y A 0.0000
95 Y A -0.1639
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 V A 0.0000
100 L A 0.3810
101 G A 0.2373
102 T A 0.8289
103 Y A 1.8210
104 Y A 1.8050
105 G A 1.0912
106 F A 0.7329
107 P A 0.2963
108 S A -0.0860
109 S A -0.3821
110 P A -0.5153
111 T A -0.4687
112 G A -0.3053
113 Y A 0.0000
114 N A -0.9883
115 Y A -0.3876
116 W A -0.0546
117 G A -0.1134
118 Q A -0.8499
119 G A -0.5419
120 T A -0.7060
121 Q A -1.0003
122 V A 0.0000
123 T A -0.1870
124 V A 0.0000
125 S A -0.6455
126 S A -0.7614
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018