Project name: c8061ec1433ba5

Status: done

Started: 2026-03-27 05:32:53
Settings
Chain sequence(s) A: DVQLVESGGGVVQPGGSLRLSCAASGRTFSSIYAKGWFRQAPGKEREFVAAISRSGRSTSYADSVKGRFTISRDNSKNTVYLQMNSLRPEDTALYYCAAVGGATTVTASEWDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:53)
Show buried residues

Minimal score value
-3.4947
Maximal score value
1.7366
Average score
-0.7436
Total score value
-92.2009

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.2254
2 V A -1.6676
3 Q A -1.1941
4 L A 0.0000
5 V A 1.1885
6 E A 0.0000
7 S A -0.1817
8 G A -0.7475
9 G A 0.1807
10 G A 0.7831
11 V A 1.5559
12 V A 0.0000
13 Q A -1.4658
14 P A -1.7320
15 G A -1.4876
16 G A -0.9705
17 S A -1.1365
18 L A -0.9701
19 R A -2.2874
20 L A 0.0000
21 S A -0.4164
22 C A 0.0000
23 A A -0.0487
24 A A -0.5503
25 S A -1.2767
26 G A -1.8014
27 R A -2.1769
28 T A -0.8574
29 F A 0.0000
30 S A -1.1792
31 S A -0.4600
32 I A 0.2498
33 Y A -0.0962
34 A A 0.0000
35 K A 0.0000
36 G A 0.0000
37 W A 0.0000
38 F A 0.0000
39 R A 0.0000
40 Q A -1.7963
41 A A -1.6326
42 P A -1.3836
43 G A -1.9340
44 K A -3.3295
45 E A -3.4947
46 R A -2.6424
47 E A -1.9668
48 F A -0.4005
49 V A 0.0000
50 A A 0.0000
51 A A 0.0000
52 I A 0.0000
53 S A -1.1806
54 R A -1.4982
55 S A -1.5393
56 G A -1.8252
57 R A -2.3324
58 S A -1.4299
59 T A -0.7500
60 S A -0.3116
61 Y A -0.6650
62 A A -1.1396
63 D A -2.4472
64 S A -1.7634
65 V A 0.0000
66 K A -2.5373
67 G A -1.6247
68 R A 0.0000
69 F A 0.0000
70 T A -0.9611
71 I A 0.0000
72 S A -0.7819
73 R A -1.4242
74 D A -1.7330
75 N A -1.9550
76 S A -1.6314
77 K A -2.3756
78 N A -1.9517
79 T A 0.0000
80 V A 0.0000
81 Y A -0.7517
82 L A 0.0000
83 Q A -1.6350
84 M A 0.0000
85 N A -1.3565
86 S A -1.1872
87 L A 0.0000
88 R A -2.6620
89 P A -2.1593
90 E A -2.4795
91 D A 0.0000
92 T A -0.5030
93 A A 0.0000
94 L A 0.6063
95 Y A 0.0000
96 Y A 0.0000
97 C A 0.0000
98 A A 0.0000
99 A A 0.0000
100 V A 0.0000
101 G A -0.4028
102 G A -0.6434
103 A A -0.2348
104 T A -0.1154
105 T A 0.4188
106 V A 1.2916
107 T A -0.0347
108 A A -0.9561
109 S A -1.2322
110 E A -2.0674
111 W A 0.0000
112 D A -2.0042
113 Y A -0.9085
114 W A -0.1205
115 G A -0.0860
116 Q A -0.8921
117 G A 0.0314
118 T A 0.6035
119 L A 1.7366
120 V A 0.0000
121 T A 0.3269
122 V A 0.0000
123 S A -0.8367
124 S A -0.5369
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018