Project name: model1pv

Chain sequence(s)	A: MIDVSKFSIQERQVLVYEIMREVEENPHDPRLKGVSWYMLDRMMMYPEDEENIKRLEELLNG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:21)

• Minimal score value: -4.0043
• Maximal score value: 1.0747
• Average score: -1.3238
• Total score value: -82.0753

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.5949
2	I	A	-0.1240
3	D	A	-1.7069
4	V	A	0.0000
5	S	A	-1.8923
6	K	A	-1.9169
7	F	A	-1.2607
8	S	A	-0.9282
9	I	A	-0.4232
10	Q	A	-1.1216
11	E	A	-1.3840
12	R	A	0.0000
13	Q	A	0.1262
14	V	A	0.8789
15	L	A	0.1895
16	V	A	0.0000
17	Y	A	0.0477
18	E	A	-1.4896
19	I	A	0.0000
20	M	A	-1.4658
21	R	A	-3.2267
22	E	A	-3.0721
23	V	A	-2.8731
24	E	A	-3.8658
25	E	A	-3.8180
26	N	A	-3.1687
27	P	A	-2.5722
28	H	A	-2.4504
29	D	A	-2.3357
30	P	A	-2.2254
31	R	A	-2.6953
32	L	A	-2.1366
33	K	A	-2.6866
34	G	A	-1.3555
35	V	A	-0.3976
36	S	A	0.2841
37	W	A	0.9867
38	Y	A	1.0747
39	M	A	0.2539
40	L	A	0.0000
41	D	A	-0.5278
42	R	A	-0.5418
43	M	A	0.0000
44	M	A	0.4656
45	M	A	0.4388
46	Y	A	0.0447
47	P	A	-1.2324
48	E	A	-2.2385
49	D	A	-3.1601
50	E	A	-4.0043
51	E	A	-3.8852
52	N	A	0.0000
53	I	A	-3.2449
54	K	A	-3.9556
55	R	A	-2.8802
56	L	A	0.0000
57	E	A	-2.3180
58	E	A	-2.6665
59	L	A	-1.4187
60	L	A	-0.7779
61	N	A	-0.7800
62	G	A	-1.2362