Project name: query_structure

Status: done

Started: 2026-03-16 23:14:15
Settings
Chain sequence(s) A: EVQLQASGGGLAQAGGSLQLSCAAPGRPVRTYTMGWFRQAPGKEREFVAANNWRGTRYAGSVRGRFSISRDNSKNTVYLQMNSLKPEDTAVYYCACAVTADLLLSGNYFRGDDYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:20)
Show buried residues

Minimal score value
-3.3196
Maximal score value
1.4393
Average score
-0.8413
Total score value
-106.0084

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.9851
2 V A -1.4395
3 Q A -1.6017
4 L A 0.0000
5 Q A -1.3334
6 A A -1.0243
7 S A -1.0323
8 G A -0.7021
9 G A -0.6497
10 G A 0.0583
11 L A 0.9590
12 A A 0.0000
13 Q A -1.3005
14 A A -1.4557
15 G A -1.3412
16 G A -1.1022
17 S A -1.0952
18 L A -0.6248
19 Q A -1.2794
20 L A 0.0000
21 S A -0.6492
22 C A 0.0000
23 A A -1.0002
24 A A 0.0000
25 P A -1.2207
26 G A -1.0903
27 R A -0.9730
28 P A -1.5627
29 V A 0.0000
30 R A -2.2609
31 T A -0.7929
32 Y A -0.1308
33 T A 0.0000
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A 0.0000
39 Q A -1.9580
40 A A -1.8606
41 P A -1.3156
42 G A -1.7896
43 K A -2.9332
44 E A -3.3196
45 R A -2.6187
46 E A -1.5570
47 F A -0.6678
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 N A 0.0000
52 N A 0.0000
53 W A -0.0770
54 R A -1.4401
55 G A -0.9648
56 T A -0.7224
57 R A -1.1670
58 Y A -0.9065
59 A A -0.8858
60 G A -1.2576
61 S A -1.1902
62 V A 0.0000
63 R A -2.4395
64 G A -1.6877
65 R A -1.5544
66 F A 0.0000
67 S A -0.9357
68 I A 0.0000
69 S A -0.7874
70 R A -1.8566
71 D A -2.3902
72 N A -2.9914
73 S A -2.2116
74 K A -2.6299
75 N A -2.4133
76 T A 0.0000
77 V A 0.0000
78 Y A -0.5371
79 L A 0.0000
80 Q A -0.8833
81 M A 0.0000
82 N A -1.2764
83 S A -1.2029
84 L A 0.0000
85 K A -2.3318
86 P A -1.9306
87 E A -2.3517
88 D A 0.0000
89 T A -0.9719
90 A A 0.0000
91 V A -0.6596
92 Y A 0.0000
93 Y A -0.5299
94 C A 0.0000
95 A A 0.0000
96 C A 0.0000
97 A A 0.0000
98 V A -0.0639
99 T A 0.3011
100 A A 0.0888
101 D A -0.9826
102 L A 0.0000
103 L A 1.4393
104 L A 1.3915
105 S A -0.0894
106 G A -0.4398
107 N A -1.3675
108 Y A -1.0094
109 F A -0.9589
110 R A -2.0219
111 G A -1.9206
112 D A -2.6304
113 D A -2.3008
114 Y A 0.0000
115 D A -1.8355
116 Y A -0.7572
117 W A -0.4353
118 G A 0.0000
119 Q A -1.4126
120 G A -0.9747
121 T A 0.0000
122 Q A -1.0501
123 V A 0.0000
124 T A -0.3509
125 V A 0.0000
126 S A -0.7927
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018