Project name: c8b358e8ab48645

Chain sequence(s)	B: GVLMLTLVARGTVGEVTSLSVEDSGSRGTLTVTMRWVQGSVEAWLRDLTF
Selected Chain(s)	B
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:17)

• Minimal score value: -3.1652
• Maximal score value: 3.2379
• Average score: -0.0302
• Total score value: -1.5097

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	B	1.5409
2	V	B	3.2379
3	L	B	3.0522
4	M	B	2.4116
5	L	B	1.8137
6	T	B	1.1705
7	L	B	1.0800
8	V	B	0.0566
9	A	B	-0.5916
10	R	B	-2.0994
11	G	B	-1.5101
12	T	B	-0.3824
13	V	B	0.0259
14	G	B	-0.2508
15	E	B	-1.1081
16	V	B	0.9683
17	T	B	0.2328
18	S	B	0.7215
19	L	B	2.2868
20	S	B	0.8977
21	V	B	0.6705
22	E	B	-2.3476
23	D	B	-3.1652
24	S	B	-2.2622
25	G	B	-2.0042
26	S	B	-1.7880
27	R	B	-3.1061
28	G	B	-2.5679
29	T	B	-1.1655
30	L	B	0.8526
31	T	B	0.7762
32	V	B	1.4109
33	T	B	0.4489
34	M	B	0.1845
35	R	B	-1.1999
36	W	B	0.3469
37	V	B	-0.0263
38	Q	B	-0.9686
39	G	B	-0.7129
40	S	B	-0.8491
41	V	B	-0.8331
42	E	B	-1.6734
43	A	B	-0.5101
44	W	B	0.3834
45	L	B	0.9695
46	R	B	-0.8606
47	D	B	-0.6392
48	L	B	1.0325
49	T	B	1.9450
50	F	B	2.5953