Project name: obj1 [mutate: VA2C, SI7C, GL15C, LK18C, SE21C, SN25C, QD39C, GH44C, SF52C, SV75C, MP83C, SH119C, TQ114C, NQ104C, LY99C, TY58C, SV63C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	GH44C,SE21C,SF52C,SN25C,LY99C,SV75C,SV63C,MP83C,TY58C,LK18C,QD39C,SH119C,NQ104C,VA2C,TQ114C,SI7C,GL15C
Energy difference between WT (input) and mutated protein (by FoldX)	18.3492 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:25)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:02:54)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:25)

• Minimal score value: -3.3487
• Maximal score value: 1.9017
• Average score: -0.4714
• Total score value: -56.5646

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.2522
2	A	C	-1.4398	mutated: VA2C
3	Q	C	-1.7563
4	L	C	0.0000
5	V	C	0.4408
6	E	C	0.0000
7	I	C	0.9839	mutated: SI7C
8	G	C	-0.0945
9	G	C	0.3224
10	G	C	1.0060
11	L	C	1.2199
12	V	C	-0.0489
13	Q	C	-1.0971
14	P	C	-0.6116
15	L	C	0.6764	mutated: GL15C
16	G	C	-0.0616
17	S	C	-0.9242
18	K	C	-1.3089	mutated: LK18C
19	R	C	-1.9339
20	L	C	0.0000
21	E	C	-0.4511	mutated: SE21C
22	C	C	0.0000
23	A	C	-0.4075
24	A	C	0.0000
25	N	C	-1.3726	mutated: SN25C
26	D	C	0.0000
27	F	C	1.2478
28	T	C	0.0900
29	F	C	0.0000
30	R	C	-1.5133
31	S	C	-0.6355
32	Y	C	-0.8430
33	E	C	-0.3702
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	D	C	-0.4052	mutated: QD39C
40	A	C	-1.0682
41	P	C	-1.3489
42	G	C	-1.5578
43	K	C	-2.3965
44	H	C	-1.6316	mutated: GH44C
45	L	C	0.0165
46	E	C	-0.4786
47	W	C	0.3104
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	F	C	1.1490	mutated: SF52C
53	G	C	0.0000
54	S	C	-0.7357
55	G	C	-0.2144
56	G	C	-0.0382
57	S	C	0.8429
58	Y	C	1.9017	mutated: TY58C
59	Y	C	1.4190
60	Y	C	0.1385
61	A	C	-0.6852
62	D	C	-1.6586
63	V	C	-0.2810	mutated: SV63C
64	V	C	0.0000
65	K	C	-1.9979
66	G	C	-1.4344
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.4567
70	I	C	0.0000
71	S	C	-0.2837
72	R	C	-1.0112
73	D	C	-1.3548
74	N	C	-1.2016
75	V	C	0.2048	mutated: SV75C
76	K	C	-1.3687
77	N	C	-1.2855
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	0.0000
81	L	C	0.0000
82	Q	C	-1.3223
83	P	C	0.0000	mutated: MP83C
84	N	C	-0.9220
85	S	C	-0.3252
86	L	C	0.0000
87	R	C	-2.0954
88	A	C	-1.8916
89	E	C	-2.2787
90	D	C	0.0000
91	T	C	-0.5343
92	A	C	0.0000
93	I	C	1.0208
94	Y	C	0.0000
95	Y	C	0.5897
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	Y	C	0.0000	mutated: LY99C
100	R	C	-3.2261
101	D	C	-3.3487
102	G	C	-1.9531
103	F	C	-1.1885
104	Q	C	-2.4640	mutated: NQ104C
105	K	C	-3.2253
106	G	C	-1.9858
107	F	C	-1.1018
108	D	C	-1.1757
109	Y	C	-0.2660
110	W	C	0.5484
111	G	C	-0.1544
112	Q	C	-0.7886
113	G	C	0.0000
114	Q	C	0.6056	mutated: TQ114C
115	L	C	1.8613
116	V	C	0.0000
117	T	C	0.1522
118	V	C	0.0000
119	H	C	-1.6046	mutated: SH119C
120	S	C	-1.4439