Project name: c9340f581ef08fd

Chain sequence(s)	V: EVQLVESGGGLVQAGGSLRLSCAASGFTFDDYAIGWFRQAPGKGREGVLCIRIFDRHTYSADSVKGRFTISSDNAQNTVYLHMNSLKPEDTAVYYCAAGSFWACTRPEGAMDYWGKGTQVTVS
Selected Chain(s)	V
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with V chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:01)

• Minimal score value: -3.302
• Maximal score value: 1.0094
• Average score: -0.8656
• Total score value: -106.4656

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	V	-2.0750
2	V	V	-1.1338
3	Q	V	-1.0557
4	L	V	0.0000
5	V	V	1.0094
6	E	V	-0.0910
7	S	V	-0.5070
8	G	V	-1.0492
9	G	V	-0.8724
10	G	V	0.0773
11	L	V	0.9317
12	V	V	0.0000
13	Q	V	-1.3093
14	A	V	-1.4371
15	G	V	-1.3694
16	G	V	-1.1153
17	S	V	-1.2822
18	L	V	-0.9046
19	R	V	-2.0379
20	L	V	0.0000
21	S	V	-0.4147
22	C	V	0.0000
23	A	V	-0.1192
24	A	V	0.0000
25	S	V	-0.9379
26	G	V	-1.1520
27	F	V	-0.9069
28	T	V	-1.1697
29	F	V	0.0000
30	D	V	-2.7160
31	D	V	-2.2963
32	Y	V	-1.3273
33	A	V	0.0000
34	I	V	0.0000
35	G	V	0.0000
36	W	V	0.0000
37	F	V	-0.3995
38	R	V	0.0000
39	Q	V	-1.7735
40	A	V	-1.7050
41	P	V	-1.2351
42	G	V	-1.6725
43	K	V	-2.7042
44	G	V	-2.3399
45	R	V	-2.4297
46	E	V	-2.2765
47	G	V	-1.2766
48	V	V	0.0000
49	L	V	0.0000
50	C	V	0.0000
51	I	V	0.0000
52	R	V	-2.7552
53	I	V	0.0000
54	F	V	-1.1889
55	D	V	-2.7358
56	R	V	-3.3020
57	H	V	-2.4876
58	T	V	-1.2268
59	Y	V	-0.2205
60	S	V	-0.6941
61	A	V	-1.4773
62	D	V	-2.4939
63	S	V	-1.8922
64	V	V	0.0000
65	K	V	-2.6543
66	G	V	-1.8690
67	R	V	-1.4899
68	F	V	0.0000
69	T	V	-0.7822
70	I	V	0.0000
71	S	V	-0.8953
72	S	V	0.0000
73	D	V	-1.7264
74	N	V	-2.2449
75	A	V	-1.4533
76	Q	V	-2.0152
77	N	V	-1.9825
78	T	V	0.0000
79	V	V	0.0000
80	Y	V	-0.5079
81	L	V	0.0000
82	H	V	-1.0806
83	M	V	0.0000
84	N	V	-1.5427
85	S	V	-1.2924
86	L	V	0.0000
87	K	V	-2.1992
88	P	V	-1.8307
89	E	V	-2.2795
90	D	V	0.0000
91	T	V	-0.9157
92	A	V	0.0000
93	V	V	-0.6817
94	Y	V	0.0000
95	Y	V	-0.3052
96	C	V	0.0000
97	A	V	0.0000
98	A	V	0.0000
99	G	V	0.0000
100	S	V	-0.3381
101	F	V	0.3258
102	W	V	0.8059
103	A	V	-0.1770
104	C	V	0.0000
105	T	V	-0.0061
106	R	V	-1.0965
107	P	V	-1.8403
108	E	V	-2.0192
109	G	V	-1.1598
110	A	V	-0.7263
111	M	V	-0.5663
112	D	V	-1.3556
113	Y	V	-0.1832
114	W	V	0.2135
115	G	V	-0.1757
116	K	V	-1.4278
117	G	V	0.0000
118	T	V	-0.8735
119	Q	V	-1.2536
120	V	V	0.0000
121	T	V	-0.4044
122	V	V	0.0000
123	S	V	-0.9105