Project name: query_structure

Status: done

Started: 2026-03-17 01:28:34
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVVYYLITYGETGYPPYSMQAFEVPGSKSTATISGLKPGVDYTITVYAHYRPWGKSGSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:26)
Show buried residues

Minimal score value
-2.6623
Maximal score value
1.8036
Average score
-0.3823
Total score value
-35.5552

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8036
2 S A 0.7645
3 S A 0.5753
4 V A 0.1630
5 P A 0.0000
6 T A -1.6327
7 K A -2.5787
8 L A 0.0000
9 E A -1.7347
10 V A 0.1896
11 V A 1.5895
12 A A 0.9237
13 A A 0.3082
14 T A -0.3436
15 P A -1.1257
16 T A -1.0013
17 S A -0.5310
18 L A 0.0000
19 L A 0.7850
20 I A 0.0000
21 S A -0.9095
22 W A 0.0000
23 D A -2.6623
24 A A -1.2013
25 P A 0.1053
26 A A 0.5312
27 V A 1.1145
28 T A 0.4664
29 V A 0.4953
30 V A 0.7245
31 Y A -0.1900
32 Y A 0.0000
33 L A -0.0985
34 I A 0.0000
35 T A -0.2567
36 Y A -0.3135
37 G A 0.0000
38 E A -0.9923
39 T A -0.7062
40 G A -0.1558
41 Y A 0.9791
42 P A 0.5202
43 P A 0.3664
44 Y A 1.1776
45 S A 0.5079
46 M A 0.1487
47 Q A -0.6183
48 A A -0.4146
49 F A -0.4302
50 E A -1.3975
51 V A 0.0000
52 P A -0.9094
53 G A -0.4784
54 S A -0.9219
55 K A -2.0060
56 S A -1.4181
57 T A -0.7423
58 A A 0.0000
59 T A 0.2428
60 I A 0.0000
61 S A -0.6568
62 G A -1.0321
63 L A 0.0000
64 K A -2.3480
65 P A -1.6466
66 G A -1.4401
67 V A -1.3761
68 D A -2.0108
69 Y A 0.0000
70 T A -0.7650
71 I A 0.0000
72 T A 0.0645
73 V A 0.0000
74 Y A 0.0965
75 A A 0.0000
76 H A -0.1919
77 Y A 0.1907
78 R A -0.8327
79 P A -0.1936
80 W A 0.3279
81 G A -0.8429
82 K A -1.7673
83 S A -0.8277
84 G A -0.4667
85 S A -0.3706
86 P A 0.0517
87 I A 0.1039
88 S A -0.3174
89 I A -0.6785
90 N A -1.7094
91 Y A -1.4594
92 R A -2.5243
93 T A -1.6443
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018