Project name: query_structure

Status: done

Started: 2026-03-16 20:33:28
Settings
Chain sequence(s) A: LPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIGYWEWDDDGEAIVLTVPGSERSYDLTGLKPGTEYPVYIAGVKGGQWSFPLSAIFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:36)
Show buried residues

Minimal score value
-3.2267
Maximal score value
2.3894
Average score
-0.6483
Total score value
-57.6985

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 1.0078
2 P A 0.5164
3 A A 0.5146
4 P A 0.0000
5 K A -1.9900
6 N A -1.3237
7 L A -0.0747
8 V A 1.1438
9 V A 0.6549
10 S A -0.6079
11 R A -1.9917
12 V A -0.9685
13 T A -1.7507
14 E A -3.0123
15 D A -2.6559
16 S A -2.0204
17 A A 0.0000
18 R A -1.1969
19 L A 0.0000
20 S A -0.3880
21 W A 0.0000
22 T A -1.2917
23 A A -1.4209
24 P A -1.3428
25 D A -2.2697
26 A A -1.4539
27 A A -1.1206
28 F A 0.0000
29 D A -2.6329
30 S A -1.3088
31 F A 0.0000
32 A A 0.0000
33 I A 0.0000
34 G A 0.0000
35 Y A 1.1348
36 W A -0.1081
37 E A -1.5498
38 W A -0.5192
39 D A -2.5412
40 D A -3.2267
41 D A -3.2177
42 G A -2.5366
43 E A -2.0713
44 A A -0.1684
45 I A 1.3269
46 V A 1.9836
47 L A 1.2938
48 T A 0.3833
49 V A 0.0000
50 P A -1.1074
51 G A 0.0000
52 S A -1.5946
53 E A -1.4917
54 R A -1.1264
55 S A -0.6436
56 Y A -0.7149
57 D A -1.6438
58 L A 0.0000
59 T A -1.3251
60 G A -1.4726
61 L A 0.0000
62 K A -2.9600
63 P A -2.5687
64 G A -1.8052
65 T A -1.9153
66 E A -1.0548
67 Y A 0.0000
68 P A 0.0000
69 V A 0.0000
70 Y A 1.0423
71 I A 0.0000
72 A A 0.0000
73 G A 0.0000
74 V A -0.6403
75 K A -1.8477
76 G A -1.6756
77 G A -1.4944
78 Q A -1.2959
79 W A 0.8126
80 S A 0.0000
81 F A 2.3894
82 P A 1.0964
83 L A 0.3411
84 S A 0.7905
85 A A 1.3472
86 I A 2.0453
87 F A 0.0000
88 T A -0.5464
89 T A -1.8378
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018