Project name: query_structure

Status: done

Started: 2026-03-16 20:08:05
Settings
Chain sequence(s) A: EAMHSFCAFKAETGPCRARFDRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKNCTRD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:48)
Show buried residues

Minimal score value
-3.7219
Maximal score value
1.56
Average score
-1.3753
Total score value
-82.5152

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.0495
2 A A -1.0612
3 M A -0.8705
4 H A -0.6894
5 S A 0.1350
6 F A 0.3357
7 C A 0.0000
8 A A 0.5072
9 F A 0.1119
10 K A -1.4977
11 A A -1.6692
12 E A -2.0891
13 T A -1.4379
14 G A -1.4448
15 P A -1.1228
16 C A -1.2468
17 R A -1.9980
18 A A -1.5775
19 R A -2.0339
20 F A -1.0885
21 D A -2.3634
22 R A -2.0036
23 W A -1.9873
24 F A -1.3404
25 F A 0.0000
26 N A -0.4967
27 I A 0.7258
28 F A 1.5600
29 T A -0.2123
30 R A -1.5464
31 Q A -2.0457
32 C A -1.9672
33 E A -1.6955
34 E A -2.4816
35 F A -1.1991
36 I A -0.8007
37 Y A 0.0000
38 G A 0.0000
39 G A -1.0322
40 C A -0.9780
41 E A -2.2183
42 G A -2.2143
43 N A -1.5895
44 Q A -1.6559
45 N A 0.0000
46 R A -1.9050
47 F A 0.0000
48 E A -2.7310
49 S A -2.4537
50 L A -2.1414
51 E A -3.2208
52 E A -3.1216
53 C A 0.0000
54 K A -3.6299
55 K A -3.7219
56 N A -2.3243
57 C A 0.0000
58 T A -3.0028
59 R A -3.1625
60 D A -2.7710
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018