Project name: query_structure

Status: done

Started: 2026-03-17 00:11:55
Settings
Chain sequence(s) A: MGVSDVPRDLEVVTATPTSLLISWDGPKYYVKYYRITYGETGGNSPVQEFTVPRTDHTATISGLKPGVDYTITVYAVKGQYGPYYGSRPISINYRTEIDKPS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)
Show buried residues

Minimal score value
-3.5287
Maximal score value
1.8574
Average score
-0.7349
Total score value
-74.9603

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.2914
2 G A 0.6580
3 V A 1.3135
4 S A -0.3973
5 D A -1.3431
6 V A -1.7752
7 P A 0.0000
8 R A -3.5134
9 D A -3.5041
10 L A 0.0000
11 E A -2.1474
12 V A 0.0659
13 V A 1.4933
14 T A 0.8025
15 A A 0.0571
16 T A -0.7337
17 P A -1.6652
18 T A -1.1576
19 S A -0.6962
20 L A 0.0000
21 L A 0.7142
22 I A 0.0000
23 S A -1.1716
24 W A 0.0000
25 D A -3.5287
26 G A -2.3099
27 P A -1.1796
28 K A -1.1450
29 Y A 0.7523
30 Y A 0.5248
31 V A -0.9059
32 K A -1.7827
33 Y A -1.3423
34 Y A 0.0000
35 R A -0.6757
36 I A 0.0000
37 T A -0.4428
38 Y A -0.2981
39 G A 0.0000
40 E A -1.7409
41 T A -1.4453
42 G A -1.3718
43 G A -1.5549
44 N A -1.5626
45 S A -0.8565
46 P A -0.3120
47 V A 0.4551
48 Q A -0.8165
49 E A -1.5695
50 F A -0.5348
51 T A -0.4140
52 V A -0.6601
53 P A -1.5212
54 R A -2.4122
55 T A -1.4874
56 D A -1.5802
57 H A -1.5192
58 T A -0.5422
59 A A 0.0000
60 T A 0.2246
61 I A 0.0000
62 S A -0.6390
63 G A -0.9892
64 L A 0.0000
65 K A -2.4004
66 P A -1.8396
67 G A -1.2743
68 V A -1.3082
69 D A -2.6384
70 Y A 0.0000
71 T A -0.8468
72 I A 0.0000
73 T A 0.0000
74 V A 0.0000
75 Y A -0.2114
76 A A 0.0000
77 V A 0.0000
78 K A -0.5663
79 G A -0.9491
80 Q A -0.7832
81 Y A 1.0825
82 G A 0.6594
83 P A 0.8179
84 Y A 1.8574
85 Y A 1.6941
86 G A 0.2334
87 S A -0.8289
88 R A -1.7151
89 P A -1.1609
90 I A -0.7418
91 S A -0.8942
92 I A -0.8376
93 N A -1.7233
94 Y A -1.4577
95 R A -1.9889
96 T A 0.0000
97 E A -2.1281
98 I A -0.7020
99 D A -2.5245
100 K A -2.4725
101 P A -1.3980
102 S A -1.0215
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018