Project name: query_structure

Status: done

Started: 2026-03-16 23:12:28
Settings
Chain sequence(s) A: EVQLQASGGGLVQGGDSLRLSCAASWFRQAPGKEREFVSRFTISRDNAKNAVYLQMNSLKPEDTAVYYCAVGQGTQVTVSSGRTLGDYGVAVISRSTIITDYANSVKGIANPVYATSRNSDDYGHW
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)
Show buried residues

Minimal score value
-4.1396
Maximal score value
2.0577
Average score
-0.7882
Total score value
-99.3121

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.2813
2 V A 0.1539
3 Q A -1.1749
4 L A -0.5847
5 Q A -1.3765
6 A A 0.0000
7 S A -1.1338
8 G A -1.0233
9 G A -0.5939
10 G A 0.3096
11 L A 1.2104
12 V A -0.0546
13 Q A -1.7481
14 G A -1.8137
15 G A -1.7705
16 D A -2.0786
17 S A -1.9631
18 L A 0.0000
19 R A -2.3022
20 L A 0.0000
21 S A -1.0207
22 C A 0.0000
23 A A -0.9017
24 A A -0.2943
25 S A 0.5498
26 W A 0.0000
27 F A -0.2836
28 R A -1.5554
29 Q A -2.5288
30 A A -2.3547
31 P A -1.4666
32 G A -1.9258
33 K A -3.7727
34 E A -4.1396
35 R A -3.8594
36 E A -2.6701
37 F A 0.0667
38 V A 0.0000
39 S A -0.6347
40 R A -1.4695
41 F A -0.8059
42 T A -0.8051
43 I A -0.5696
44 S A -1.1154
45 R A -2.8948
46 D A -2.9588
47 N A -3.0860
48 A A -2.2040
49 K A -3.1441
50 N A -3.0686
51 A A -2.1952
52 V A 0.0000
53 Y A 0.0000
54 L A 0.0000
55 Q A -1.2379
56 M A 0.0000
57 N A -2.2642
58 S A -1.9616
59 L A 0.0000
60 K A -2.5552
61 P A -1.6661
62 E A -2.4661
63 D A -1.7350
64 T A -1.1628
65 A A 0.0000
66 V A -0.1913
67 Y A 0.0000
68 Y A 0.0302
69 C A 0.0000
70 A A 0.0337
71 V A 0.4158
72 G A -0.3837
73 Q A -0.5122
74 G A 0.0207
75 T A 0.0000
76 Q A 0.0000
77 V A 0.0000
78 T A 0.0000
79 V A 0.0000
80 S A 0.2302
81 S A -0.7119
82 G A -0.7400
83 R A -2.0393
84 T A -0.8434
85 L A 0.3328
86 G A -0.6679
87 D A -1.7752
88 Y A -0.6568
89 G A 0.0000
90 V A 0.0000
91 A A 0.4907
92 V A 0.0000
93 I A 0.8200
94 S A -0.4428
95 R A -0.5593
96 S A -0.2794
97 T A 0.8251
98 I A 1.6499
99 I A 0.9733
100 T A -0.2279
101 D A -0.8601
102 Y A 0.2434
103 A A -0.1280
104 N A -1.1022
105 S A -0.5866
106 V A 0.7476
107 K A -0.9214
108 G A 0.0148
109 I A 1.4094
110 A A 0.2998
111 N A 0.0154
112 P A 0.9723
113 V A 2.0577
114 Y A 1.9494
115 A A 0.8695
116 T A -0.4790
117 S A -1.5098
118 R A -2.8890
119 N A -3.0652
120 S A -2.6353
121 D A -3.1198
122 D A -2.3648
123 Y A -0.3891
124 G A -0.4086
125 H A -0.3802
126 W A 0.5392
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018